KEGG   Nitratireductor sp. SY7: FQ775_05415
Entry
FQ775_05415       CDS       T06518                                 

Definition
(GenBank) xanthine dehydrogenase family protein molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
niy  Nitratireductor sp. SY7
Pathway
niy00230  Purine metabolism
niy01100  Metabolic pathways
niy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:niy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    FQ775_05415
Enzymes [BR:niy01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     FQ775_05415
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QDY99856
UniProt: A0A5B8KVY0
Position
complement(3425152..3427458)
AA seq 768 aa
MTIHDHPAAAKQSFSVVGKSVKRSDTLEKVTGTALYAGDIILPGMLHGKIKRSDIAHARI
KSIDTSKALALKGVKAVLTHENVPRVLHYGSPHPRSASVTKDQYILDDRVRYWGEGVAAV
AAISEEIAEEALGLIEIEYEPLPAVFTVEDALKPDAPAIHDNGLEKNNVLAPVVVERGDV
EKGFAEADLVLEGEYELGRPTPAYMEPNVCVTQWDGNGKLTIWSSTQTAFMVRGALAEVL
GVPLNKVRVIVDHMGGGFGAKQDLFQHEFLSALLARETARPVRMEFTRKETFLGGRSRHP
GKIWLKQGFTKDGRITARQARIVFNSGAYGSHGPGVTNVGTAAMTSLYRCENVHLEGRCI
YTNTPIAGAFRGYGVVQTYFAIDLQVDEAAERLGFDPAEFKLKNAVREGDIAPSGHPIVG
HGLEDCIRRGMEESDWAAVRKAPKGNGVKRRGWGIGCEMHGSSAYPGIKEQGNAIVKMNE
DGTVTLLTGTAGLGTGAHTALSQIVAEELGVPFEDISVVQGDTDVVPWDIGAFASHTTYM
GGRAAQFAAADVRRQILAHAAPMLDSSLEELTIVDGVILRLDGSNRSMSLREAVAPQRGM
PAIQLVGVGTYTPTKSYSFGAHFTEVEVDTETGEVAVLQVIPVHEIGKVIHPVAAAGQIE
GGIQQGIGHTLSEDYVIDLTNGRSLNPSFVDYKMPLSMDMPPIRTIILETAPDPGGPWGA
KGVGEDPIIAIGPAIANAIHDAIGVRFRHYPITPENILDALRAQKKEA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgaccatccacgaccaccccgccgccgcgaagcagtccttctcggtcgtcggcaagagc
gtcaagcgctccgatacactggagaaggtgaccgggaccgcgctttatgccggcgacatc
atcctgcccggcatgctgcacggcaagatcaagcgcagcgatatcgcccatgcccgcatc
aagtcgatcgacacctcgaaggcgctggcgctgaagggcgtcaaggcggtgctcacgcat
gagaacgtgccgcgcgtgctgcattacggttcgccgcacccgcgctcggcctcggtgacc
aaggaccagtacattctcgacgaccgggtccgctactggggcgagggcgttgccgctgtc
gccgccatcagcgaggagatcgccgaggaggcgctcggcctgatcgagatcgaatatgag
ccgctgccggccgtcttcaccgtcgaggatgcgctgaagccggatgcgccggcaatccac
gacaacggcctggaaaagaacaacgtgctcgcccctgtcgtggtcgagcgcggcgacgtc
gagaagggcttcgccgaggccgacctggtgctcgagggcgaatacgagctcggccggccg
acaccggcctacatggagccgaatgtctgcgtcacccagtgggacggcaacggcaagctc
accatctggagctcgacccagaccgccttcatggtccgcggcgcgctcgccgaggtgctc
ggcgtgccgctcaacaaggtgcgcgtcatcgtcgaccatatgggcggcggtttcggcgcc
aagcaggacctgttccagcacgagttcctgtcggccctgctggcgagggaaacggcgcgg
ccggtgcgcatggagttcacgcgcaaggaaaccttcctcggcggccgctcgcgtcatccc
ggcaagatctggctcaagcagggcttcaccaaggacgggcgcatcaccgcgcggcaggcg
cgcatcgtcttcaattccggtgcctatggctcccacggaccgggcgtgaccaatgtcggc
accgcggcgatgacgtcgctctaccgctgcgagaacgtgcatctcgaaggtcgctgcatc
tacaccaacacgccgatcgccggcgccttccgcggctacggcgtggtgcagacctatttc
gccatcgatctgcaggtcgacgaggcggccgaacggctgggtttcgacccggccgagttc
aagctgaagaatgccgtccgcgaaggcgacatcgccccgtcgggtcacccgatcgtcggc
cacgggctcgaggactgcatccgccgcggcatggaggagagcgactgggccgcggttcgg
aaggcccccaagggcaatggcgtcaagcgccgcggctggggcatcggctgcgagatgcac
ggctccagcgcctaccccggcatcaaggagcagggcaacgccatcgtgaagatgaacgag
gacggcaccgtcacgctgctgaccggcaccgctggcctcggcaccggagcccacaccgcg
ctgtcgcagatcgttgccgaggaactcggcgtgccgttcgaggacatctcggtagtgcag
ggcgacaccgacgtcgtgccctgggacatcggcgcctttgccagccacaccacctacatg
ggcgggcgcgccgcgcaattcgcggccgccgacgtgcggcgccagatcctggcgcatgcg
gcgcccatgctcgactcctcgctcgaggagctgaccatcgtcgacggcgtcatcctgcgt
cttgacggctccaaccggtcgatgtcgctcagggaggcggtcgcgccgcaacgcggcatg
ccggcgatccagctcgtcggcgtcggcacctatacgccgaccaagtcctattccttcggg
gcgcatttcaccgaggtcgaggtcgataccgagaccggcgaggtcgcggtcctgcaggtg
atccccgtgcacgagatcggcaaggtgatccacccggtggcggccgccggccagatcgag
ggcggtatccagcagggcatcggccacacgctgagcgaggactatgtcatcgatctcacc
aacggccgatcgctcaatccgagtttcgtcgactacaagatgccgctgtcgatggacatg
ccgccgatccgcaccatcatcctggagaccgcgcccgatccgggcggtccctggggcgcc
aagggtgtcggcgaagacccgatcatcgccatcgggccggcgatcgccaacgccatccac
gacgcgatcggggtgcgcttccgccactatccgatcacgccagaaaacatcctcgacgcg
ctgcgcgcgcaaaagaaggaggcctga

DBGET integrated database retrieval system