KEGG   Niastella koreensis: Niako_0362Help
Entry
Niako_0362        CDS       T01679                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nko  Niastella koreensis
Pathway
nko00260  Glycine, serine and threonine metabolism
nko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01130  Biosynthesis of antibiotics
nko01230  Biosynthesis of amino acids
Module
nko_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Niako_0362
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Niako_0362
Enzymes [BR:nko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Niako_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEV96760
UniProt: G8TQM6
Position
434868..436115
Genome map
AA seq 415 aa AA seqDB search
MTTTTTYQQPNVQGYYGKFGGAFIPEMLHRNVEELRSKYLDIIYDPAFQKEYKALLHDYV
GRPSPLYYAKRLSEQYGTQIYLKREDLCHTGSHKLNNALGQILLAERLGKKRIIAETGAG
QHGVATATVCALKGVECIVYMGEKDIERQAPNVARMKMLGATVIPATSGSKTLKDATNEA
IRDWINNPVDTHYIIGSVVGPHPYPDMVARFQSIISEEIRYQLKEQAGTELPSHVLACVG
GGSNAAGTFYHFLEEPTVQLVAVEAAGHGVHSGLSAATTQLGKPGVLHGSKSLVMQTEDG
QVVEPHSISAGLDYPGIGPLHANLYDSGRGVFLSATDEEALQAAFNLAQKEGIIPALESS
HALASLEFLNPLKPKKTEAPIPAKAMFTKDSTVVVCLSGRGDKDMATYMKAMESK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaacaacaacatatcaacaaccaaatgtacaggggtattatggaaagttcggt
ggcgcattcattcccgaaatgctgcaccgcaatgtggaagagctgcgttcaaaatacctc
gacattatttacgatcctgctttccagaaagaatataaggctctgttgcacgattatgta
ggccggccttcgccgctgtattatgccaaacgcctgagtgaacaatacggtacgcagatt
tacctgaaacgggaagacctgtgtcataccggttcgcataaactgaataatgccctcggc
cagatcttactggcagagcgcctgggcaaaaaacgcattatcgccgaaaccggcgccggc
caacacggtgtggctaccgccactgtatgtgcgttgaaaggagtggagtgtattgtgtat
atgggtgaaaaagacatcgagcggcaggcgcccaatgtggcccgcatgaaaatgctgggc
gctacggtgatccctgcaaccagcggcagcaaaacattgaaagatgctaccaatgaagct
atccgcgactggatcaacaatcccgtggatactcactatataattggcagtgtggttgga
ccgcacccatatcctgatatggtagcacgttttcaaagtatcatcagtgaagaaatccgt
taccagttaaaagaacaggcaggtactgaattgccttcccacgtactggcctgtgtaggc
ggcggcagtaatgcagccggtacattttatcatttcctggaagagccaaccgtacaactg
gtagctgtagaagcggccggacatggcgtacacagcggcttaagcgctgctaccacgcag
ttaggtaagccaggggtattgcatggcagcaaaagcctggtaatgcaaaccgaagatgga
caggtggtagaaccacacagcatttctgcagggcttgattacccgggcattggaccattg
catgccaacctgtatgattcaggccgcggcgtgttcttaagcgctaccgatgaagaagct
ttacaggcagcctttaacctggcgcaaaaagaaggcatcatccccgcgttggaaagttcc
cacgccctggccagcctggagtttctgaacccgctgaaacctaaaaaaacagaagcgcct
ataccggcaaaagctatgttcacaaaagattcaacggtggtggtttgtttaagtggaaga
ggtgataaagacatggctacttatatgaaagcaatggaatcgaaataa

DBGET integrated database retrieval system