KEGG   Niastella koreensis: Niako_0534Help
Entry
Niako_0534        CDS       T01679                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nko  Niastella koreensis
Pathway
nko00010  Glycolysis / Gluconeogenesis
nko00052  Galactose metabolism
nko00500  Starch and sucrose metabolism
nko00520  Amino sugar and nucleotide sugar metabolism
nko00521  Streptomycin biosynthesis
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01120  Microbial metabolism in diverse environments
nko01130  Biosynthesis of antibiotics
nko01200  Carbon metabolism
Module
nko_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_0534
   00052 Galactose metabolism
    Niako_0534
   00500 Starch and sucrose metabolism
    Niako_0534
   00520 Amino sugar and nucleotide sugar metabolism
    Niako_0534
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Niako_0534
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Niako_0534
Enzymes [BR:nko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Niako_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEV96929
UniProt: G8T7Z1
Position
645368..646246
Genome map
AA seq 292 aa AA seqDB search
MTNPSIVIGADIGGSHITAAQVDLTSHQLITSSLVRLPVNSMATAQEVITTWAQGIKQAM
QQQRFEKICLAMPGPFDYEAGICLISDQNKYPLLYGLNVKELLAPVLEVTTNDIHINNDA
ACFLQGEVFSGKVKGYQHAVSVTLGTGLGTAIYENGAARSADRWNMPLLDSMAEEYLSTR
WFVKQYAAVTGEQIHGVRELAAQALSNNLVKGLFAEFGKNLAVFLNRFLDETGAKAVVIG
GNITQSYPLFKNALLAGMESRHADVFITTSVLGELAAVLGAGSFCCQQPNFI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacccttccattgttataggtgcagatatcggcggatcacacatcaccgccgcg
caggttgatttgaccagtcatcaattgatcacttcttcgctggtgcggttgccggtgaac
tcaatggcaaccgcacaggaagtaattacaacctgggcgcagggcattaaacaggccatg
caacaacaacggtttgaaaagatctgtctggcaatgccgggtcccttcgactatgaagca
ggcatttgccttatcagcgatcaaaacaaatacccgttgttatatgggctgaacgtaaag
gaattactggcgccggtattggaggtgaccaccaatgatattcacataaacaacgacgcc
gcctgttttttgcagggcgaggtatttagtggcaaggtgaaaggttatcagcatgcggtg
agcgttaccctgggcaccggattgggaacggctatttatgaaaatggagcagccaggagc
gctgatcgctggaatatgcctttgcttgatagcatggcagaagaatatttgagcacccgc
tggtttgtaaaacaatatgcagccgtcaccggtgaacagatccatggagttcgggaactg
gctgcacaggctttgtcgaacaacctggtaaaaggtttgtttgcggagtttggcaagaac
ctggcagtctttttaaaccggtttttggatgaaacgggtgcaaaggccgtggttattggc
gggaatatcacccagtcgtacccgctgtttaaaaatgcattgttagcgggcatggaaagc
cgtcatgccgatgtgttcatcaccacctcggtactgggcgaactggctgccgtactgggc
gccggaagtttttgttgtcagcaacccaactttatttaa

DBGET integrated database retrieval system