KEGG   Niastella koreensis: Niako_2325Help
Entry
Niako_2325        CDS       T01679                                 

Definition
(GenBank) ornithine cyclodeaminase/mu-crystallin
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
nko  Niastella koreensis
Pathway
nko00998  Biosynthesis of secondary metabolites - other antibiotics
nko00999  Biosynthesis of secondary metabolites - unclassified
nko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    Niako_2325
   00999 Biosynthesis of secondary metabolites - unclassified
    Niako_2325
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     Niako_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall UDPG_MGDP_dh_C Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AEV98669
UniProt: G8TKJ5
Position
complement(2803043..2804008)
Genome map
AA seq 321 aa AA seqDB search
MKYLNEDDIKKIGVNWPAVTTVIRKACKTMAQEDFAQPIKPYLRYRNRKNRIIAMPGFLG
GETELAGIKWIASFPDNINKGIRRAHSVIILNDAATGQPVSIINTPLLSGIRTAGVSGLM
VELWLKYNHMSRIRVGMCGLGPIGRLHTDMLFGLLGDRIEMVSIYDIRPCEKMVSEHPHA
DSIRICDTWQEAFSNADIFVTCTVSNGPYIDSMPKKGSLHLNVSLRDYMASWIQYADTII
VDDWDEVCRENTDIENMHLNHGLQKQQVYNIVELVAGIGLSQLKQPQTVMFNPMGMSVFD
IAVAGHYFTRAEQLTVGTELE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttaaatgaagatgatataaaaaagataggtgtaaactggcctgctgttaca
acggtgatacgtaaggcctgcaaaacaatggcgcaggaggattttgcgcagcctatcaaa
ccctacctgagatacaggaacaggaagaacaggatcattgccatgccgggatttttaggc
ggtgaaacggaactggcaggcataaagtggattgccagttttcccgacaatataaacaaa
gggatcaggcgggcgcattccgttataatcctgaatgatgcggccaccgggcagccggtg
agcattattaacacacctttgttaagtggcataagaacggccggggtatcgggccttatg
gtagagctttggttaaaatataaccacatgagcaggatcagggtaggcatgtgcggactg
ggccctattggcaggctgcataccgatatgttattcggattgctgggtgaccgtatagaa
atggtaagtatatacgatatcaggccatgtgaaaaaatggtaagcgaacatcctcatgct
gacagtatcaggatctgcgatacctggcaggaagcattttcaaacgcagatatttttgtt
acctgtacggtatcaaacggcccctatattgacagtatgcccaaaaaaggttcattacac
ctgaacgtttcgctgagagattatatggcatcctggatccaatatgccgatacgatcatt
gttgatgactgggatgaagtttgcagagaaaataccgacattgaaaatatgcatctgaac
cacggcctgcagaagcaacaggtatacaatatagtcgaattggtggccggcattggtttg
tctcagttgaaacaaccgcaaacagtgatgttcaacccaatgggaatgtcggtattcgac
attgcagtagccgggcattattttaccagggcggaacaacttaccgtaggaactgaactt
gaataa

DBGET integrated database retrieval system