KEGG   Niastella koreensis: Niako_2599
Entry
Niako_2599        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB
Motif
Pfam: TssD
Other DBs
NCBI-ProteinID: AEV98939
UniProt: G8TR25
Position
complement(3227200..3227589)
AA seq 129 aa
MSFIAKLKLDGEELNILHCAYRFTQATDGTGKPTAIPQGGSVTLVVESNGETGLFDWMIS
PTQTKSGTITFYRRDNMSKLKSLQFTDAHCVDYYETYDHNGDSPMRIQLTLSAKEVKLNE
SKFRNNWPQ
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcatttatagcaaaacttaagttggatggcgaagagttgaacatcctgcattgtgca
taccgttttacgcaggccaccgatggcaccggcaaaccaaccgctattccccagggcgga
tcggttaccctggtagttgaaagcaatggcgaaaccggtttgttcgactggatgataagt
ccaacccaaacaaaaagcggcaccattactttttatcgccgcgacaacatgagtaaatta
aaaagcctgcagttcacggatgcgcactgtgttgattattacgaaacctatgatcacaac
ggtgacagtcccatgcggatacagttaacactcagcgccaaagaagtaaaactgaacgaa
tcaaaattcaggaacaactggccacaataa

DBGET integrated database retrieval system