KEGG   Niastella koreensis: Niako_2611
Entry
Niako_2611        CDS       T01679                                 

Definition
(GenBank) gpW/GP25 family protein
Organism
nko  Niastella koreensis
SSDB
Motif
Pfam: GPW_gp25 MbeB_N
Other DBs
NCBI-ProteinID: AEV98951
UniProt: G8TR37
Position
complement(3240647..3241081)
AA seq 144 aa
MRLKYYTLPLDPDLLMQKKEHPGCSLKQSVGHHLHLIITTAFGEMQSDVDFGNSIWDHDF
DNLTARTRQQEWMKESLLQAIRKHEKRLDAIKVDVLVKQEEVNALSTERRVKKRLDINIS
ARLTATSEDITFRDSFFVSPLSYS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcggcttaagtattataccttaccattggatcccgacttgctgatgcaaaagaaagag
catcctggttgttccttaaaacaatctgtaggccatcacctgcatcttattattaccacc
gcatttggcgaaatgcaaagtgatgttgactttggcaattccatctgggaccatgatttt
gataatcttactgcccgcacccggcaacaggaatggatgaaagaatccctgttacaggcc
attcgcaaacatgaaaaaagactggatgccattaaagtagatgtactggttaaacaggaa
gaagtaaacgcactatctacagaacgacgcgttaaaaaacgcctcgatattaatatttcc
gcccgactcacggctacaagcgaagacattactttccgcgacagcttttttgtgagcccg
ttatcatatagttaa

DBGET integrated database retrieval system