KEGG   Niastella koreensis: Niako_2745Help
Entry
Niako_2745        CDS       T01679                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
nko  Niastella koreensis
Pathway
nko02020  Two-component system
nko02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nko00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Niako_2745
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Niako_2745
Enzymes [BR:nko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Niako_2745
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Niako_2745
Two-component system [BR:nko02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Niako_2745
Bacterial motility proteins [BR:nko02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Niako_2745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: AEV99081
UniProt: G8T8B1
Position
3412623..3413213
Genome map
AA seq 196 aa AA seqDB search
MEKNEITTGAVIVIGGSAGSLEVILDITNNLPLFATVIIIIVVHRKIDNDSILEDLVAHK
TLYAVKEVEDKDAIIPGTIYIAPPDYHLLIENKDSFSLDSSEKIHYSRPSIDVTFESVAG
VFTNRVMGILLSGANADGAAGLACIKEMGGHTLVQNPASAEMSIMPQQAINRNIVDRIAE
PAQISEAIVRFITLVS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaacgaaataaccaccggcgcagtaattgtcatcggcggttcagccggcagc
ctggaggtaattcttgacatcactaacaacctgccgttgtttgcaacggttatcattatt
attgtggttcaccggaagatcgacaatgactccatcctggaagacctggttgcccacaaa
accctgtacgcagtaaaagaggtggaagacaaagacgcgattattcccggcactatttat
attgccccacccgattatcacctgctgattgaaaacaaggatagcttctccctcgacagc
tcggaaaaaatacattacagccggcccagcatcgacgtaacatttgaatcggtagccgga
gtatttaccaacagggtgatgggtattttattaagcggcgccaatgccgatggagcagcc
ggactggcctgcattaaagaaatgggtggccataccctggtacaaaaccccgcaagcgcc
gaaatgagtattatgccgcaacaggccattaaccgaaatattgtagaccgcattgcggag
cccgcgcagatcagcgaagccatcgttcgctttataacccttgtttcctga

DBGET integrated database retrieval system