KEGG   Niastella koreensis: Niako_2844Help
Entry
Niako_2844        CDS       T01679                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
nko  Niastella koreensis
Pathway
nko00220  Arginine biosynthesis
nko00330  Arginine and proline metabolism
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01130  Biosynthesis of antibiotics
nko01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Niako_2844
   00330 Arginine and proline metabolism
    Niako_2844
Enzymes [BR:nko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Niako_2844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase TMEM214
Motif
Other DBs
NCBI-ProteinID: AEV99178
UniProt: G8T9I8
Position
complement(3560457..3561359)
Genome map
AA seq 300 aa AA seqDB search
MTGHKINLFEFPTNLGLIKTDYAIEPGVKKLPDWLKQFGFHDQVNPDKVVRLEPPAYTML
VDKASQVRNADSIVAYAKEQAALLYNEINDDSFQLILGGDCSILIGSAVALRQKGKYGIF
YLDGHTDFIWPEMSGTHGAAGMDLAIVAGHGHEKLTNINNLKPYIQEEHIYCVGNREYDA
NYEKPVIDSNVAYYPLNRLRGNGLQNTVQQFLQTVKQQNLDGFFIHFDVDALDDQVMPAV
DSRTPDGLSYDELAEILAPLLSSRKAVGMEITILDPDLDEDGRYTKEFSDKIVKLINGAK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccataaaataaacctgttcgaatttccaaccaacctgggattgataaaaacc
gattatgccattgagccaggtgtaaagaagttgcccgattggttaaaacaattcggtttt
catgatcaggtcaatcctgataaagttgttcgtttggaaccaccggcttataccatgctg
gttgataaagcatcgcaggtaagaaatgccgatagtattgtggcctatgcaaaagaacag
gctgcgcttttgtacaacgaaatcaatgatgattcttttcaactgatccttggtggtgat
tgcagtattcttatagggagcgctgttgcattgcggcaaaaagggaagtatggaatattc
tacctggacggacatactgattttatctggcccgaaatgtcgggcacccatggcgctgct
ggtatggatctcgctatagtagcgggtcacggccatgaaaagctgactaatatcaataat
ctgaaaccatatatccaggaagaacatatttactgtgtgggtaaccgcgagtacgatgct
aattatgagaaacctgtcatcgactccaatgtagcctattatccactcaatcgcttacgg
ggaaatggattgcaaaataccgtgcaacaatttcttcaaacggtgaaacaacaaaacctg
gatgggttctttattcattttgatgtggatgccctggatgaccaggttatgccggcggtt
gacagccgcacaccagatgggctttcgtacgatgagctggctgagatcctggctccatta
ctatcgagcaggaaagcagttggcatggaaattaccatcctcgatcctgatctggatgag
gatggtaggtatacaaaagagttcagtgataaaatagttaagctaataaatggggcaaaa
taa

DBGET integrated database retrieval system