KEGG   Niastella koreensis: Niako_3589Help
Entry
Niako_3589        CDS       T01679                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nko  Niastella koreensis
Pathway
nko00630  Glyoxylate and dicarboxylate metabolism
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01120  Microbial metabolism in diverse environments
nko01130  Biosynthesis of antibiotics
nko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Niako_3589
Enzymes [BR:nko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Niako_3589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEV99889
UniProt: G8TNH2
Position
complement(4505058..4506302)
Genome map
AA seq 414 aa AA seqDB search
MERIIATYYIETPLQVEKAAEVLAGEQSSGTFIAVPGETEELKRRFAARVEKVTPLETVT
TPAMPGAASSNGQYHRAEIQVSWSIENFGYNLPVLTSTLQGNLYELRQFTGLKLIDIELP
ASYAQHYKGPAFGVKGCRQLTNVQDRPLIGTIIKPSIGLTPEQTADMVKTLAGAGIDFIK
DDELLSSSANSLFKDRVDAIMKVINAHADATGKKVMYAFNISGEIDEMLQRYEYIVKSGG
TCAMVSINSVGMAGVKKICDQHQLAIHAHRNGWGMQTRHPLLGIDFRAYQKLWRVAGVDQ
LHVNGIQNKFWESDDSVVASIKALQTPFYNHESPIPVVSSGQWGGQAPETYRRTKTVDLL
YMAGGGIMAHPMGAAAGVVALQQAWQAAVDGLSIEQAAGKYKEFSESVKQFGKK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaataatagcaacgtattatatcgaaactcccttacaggtggagaaagccgct
gaagtattagccggtgagcaatcatcagggacctttatagctgtgcccggtgaaaccgaa
gaattgaaacgacgctttgcggccagggtagaaaaagtaacgccgttggaaactgttact
acgcctgccatgcccggcgctgccagcagcaatggacaataccatcgtgccgagattcag
gtttcttggagcattgagaactttggttataacctgccggtgttaacatcaacgctgcag
ggaaatttgtatgagctccgccagttcacggggttgaagttgatagatattgagctgcct
gcttcttatgctcagcactataaaggacctgcttttggagttaaaggttgccgtcagttg
acgaacgtgcaggacaggccattgatcggtaccatcataaaaccaagcattgggcttacg
ccggagcaaacggccgacatggttaaaaccctggccggcgcggggatcgactttataaaa
gacgatgagttgttgtcttcatcagccaactccttgtttaaagacagggtagatgcgatc
atgaaagtgatcaatgcccatgcagatgccaccggtaaaaaagtgatgtatgcgtttaac
atcagcggtgaaatagatgaaatgctgcaacgctatgaatacatagtaaagagtggcggc
acctgtgccatggtaagcatcaacagcgtaggtatggccggcgtgaaaaagatctgcgat
cagcaccagctggctattcatgcccaccgcaatggctggggcatgcaaacccgtcatccg
ttgttaggaattgattttcgcgcatatcagaagttatggcgtgtagccggtgttgaccaa
ttgcatgtaaatgggattcagaataaattctgggagagcgatgattctgtagtagcttct
ataaaagcattgcaaacgccgttctataaccacgagtcgccaataccggtagtttcttcc
ggccagtggggcggacaggcgccggaaacgtatcgccgcaccaaaacagttgatctgttg
tatatggccggtggtggcattatggcgcatcccatgggcgcagcagcgggtgtagtagct
ttacaacaggcctggcaggctgcggtggatgggttgagtatagaacaggcagcgggtaag
tataaggagttttcggagtcagtgaagcaattcggtaaaaagtaa

DBGET integrated database retrieval system