KEGG   Niastella koreensis: Niako_4417Help
Entry
Niako_4417        CDS       T01679                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nko  Niastella koreensis
Pathway
nko00020  Citrate cycle (TCA cycle)
nko00310  Lysine degradation
nko00380  Tryptophan metabolism
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01120  Microbial metabolism in diverse environments
nko01130  Biosynthesis of antibiotics
nko01200  Carbon metabolism
Module
nko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Niako_4417
  09105 Amino acid metabolism
   00310 Lysine degradation
    Niako_4417
   00380 Tryptophan metabolism
    Niako_4417
Enzymes [BR:nko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Niako_4417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEW00676
UniProt: G8TI59
Position
5524385..5525758
Genome map
AA seq 457 aa AA seqDB search
MALVDLVMPKMGESITEATILKWFKNPGETVKMDEAVLEIATDKVDSEVPSVAEGVIEET
FFKVNDVVPVGTVLARIRSNAAEPATTNTPVVTSPAVEIAVNRAVPDEVYHQPVATDSFT
HQPAAQNGARFYSPLVLNIATSEGVPFSELENIPGSGTDGRVTKKDILQYVANKKAGKPG
ISTAHTVTATPVHKQEDTTPTILPQVRQVEPQPQQHIQSYSGNVEIVELDRMRKMISEHM
IRSQDTSAHVTSFTECDVTNLVHWRDKVKKQFEKQEGEKLTFTPLFIEAIIRCIKKYPWL
NSSVDGDKLIVKKDINIGMAAALPTGNLIVPVIRNADQLNLVGLTRQVNSLANAARNNKL
KPDDTQGGTFTITNVGTFGSLMGTPIINQPQVAILATGAIKKRPVVIETEQGDFIAIRNM
MYLSLSYDHRVIDGALGSTFLGAVAKELENFSADRTI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggctctagttgacctggtgatgcctaaaatgggtgaaagtattacagaagccactatt
ttaaagtggtttaaaaaccccggtgaaacggtgaagatggatgaggcagtacttgaaatt
gccactgataaggtggacagtgaagtaccttctgtggccgagggtgtaatagaagaaacc
tttttcaaagtaaacgatgtggtgcctgttggtaccgtgctggcccgcatcaggtcaaat
gctgcagaacctgccacaacaaatacgccggtggttaccagtccggcggttgaaatagcc
gtgaaccgcgctgtaccggatgaggtgtatcaccaaccggtagccactgactcgtttaca
caccagcctgctgcccagaacggcgcccgtttttactcgcccctggtgctgaacattgct
accagcgaaggcgttcccttcagcgaactggaaaatattcccggttcaggaaccgatggg
cgtgttaccaaaaaagacattctgcagtatgtagccaataagaaagccggcaaaccaggc
atttccaccgcacataccgttactgccacgcctgttcacaaacaggaagacaccacgcct
actatacttcctcaggttagacaggttgaaccacagcctcagcaacatattcaatcgtac
agcggtaatgttgagatcgttgaactggaccgcatgcgtaaaatgatctctgagcacatg
atccgcagccaggataccagcgcacacgtaaccagctttactgagtgcgatgtaaccaac
ctggtgcactggcgcgataaggttaaaaaacagtttgaaaaacaggaaggcgaaaaactc
acctttacgccgttgttcattgaagccattattcgctgtattaaaaaatatccatggctc
aacagcagtgtggatggtgataaactgatcgtaaagaaagatatcaatataggcatggcc
gccgccctgcccaccggtaacctgatcgttccggttatccgcaacgccgaccagctgaac
ctggttggattgacccgccaggtgaattcactggcgaatgcggcccgcaacaacaaatta
aaacccgatgatacccagggtggcacctttacgataaccaatgtaggtacgtttggcagc
ttaatgggtacgcccatcatcaaccaaccccaggtagctattctggcaaccggtgctatc
aaaaaaagaccggtggtaattgaaaccgaacagggtgactttattgccatccgcaacatg
atgtacctgtcgctgtcgtacgatcaccgcgtaatcgatggtgccctgggttctaccttc
ctgggtgcagtagccaaggagctggagaacttttctgcggacagaacaatataa

DBGET integrated database retrieval system