KEGG   Niastella koreensis: Niako_5020Help
Entry
Niako_5020        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEW01259
UniProt: G8T8S9
Position
6217492..6217836
Genome map
AA seq 114 aa AA seqDB search
MSIDSNNNPRIDAVLNSLDGMQRAKAPDFLYTRLQGRMEREFDQGGPIGRWLTKPVLALT
IAAIVLIANATTVLKMWKQNTASSTINTESGQVVAAEYPAGGVYPVYNENSLEP
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcgattcaaataacaaccccaggatagatgcggtgctgaatagcctggatggg
atgcagcgggccaaagcgcctgatttcctgtatacccgcctgcaagggaggatggagagg
gagtttgaccagggtggccccataggccgctggttgacaaagcctgttttggctttaacg
attgctgcaatcgtgcttattgcaaatgctactactgtgttaaaaatgtggaagcagaac
acggcttcctcaaccataaatactgaatcaggtcaggtagtggcggctgaataccctgca
ggtggtgtgtaccctgtatataatgaaaattcactggaaccatga

DBGET integrated database retrieval system