KEGG   Niastella koreensis: Niako_5022Help
Entry
Niako_5022        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mac-1
Motif
Other DBs
NCBI-ProteinID: AEW01261
UniProt: G8T8T1
Position
6218726..6219406
Genome map
AA seq 226 aa AA seqDB search
MRSTLLLASFACLLTNAALAQDCNAFYFLQKNKTIEMSIYNKKGDASGKQVYSVSDVTNS
GDNITATVNSEMFDKKGKSIAKGHSQIVCNGGVMMIDMTMQLPQAQQEQFSKADVKADKI
FIEYPNNMKEGDKLKDATLSMDIDNAGMKQSINMVTSDRTVTGKESVTTTAGTWDCFKIT
YKSKITIKTMGIGMPFNIEGTEWFAPRFGIVKTESKNGGTAITAIK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcaactcttttgctggccagcttcgcctgcctgctcaccaacgccgctctggcc
caggattgtaacgccttctattttcttcaaaaaaacaagaccattgaaatgagcatctac
aataagaagggcgatgccagcggcaaacaggtatattcagtttcggatgttaccaatagc
ggtgataatattacagccaccgttaattcagaaatgtttgataaaaagggaaagtctata
gccaaaggtcatagccagatcgtgtgcaacggcggcgttatgatgattgatatgaccatg
caattgccccaggcgcaacaggagcaattttccaaagccgatgtaaaggctgacaagatc
ttcatagaatacccaaataacatgaaggagggtgataaattaaaagatgctacgctgagt
atggacatcgacaacgccgggatgaagcaaagcatcaacatggttaccagcgatcgcacg
gtgacaggtaaagaaagtgttactactactgccggcacctgggactgttttaaaattact
tacaaaagcaagatcactataaaaacaatgggcattggcatgccctttaatattgaagga
acagaatggttcgcaccccggttcggcatagtaaaaacggaaagcaaaaatggcggtaca
gcaataacagccatcaaataa

DBGET integrated database retrieval system