KEGG   Niastella koreensis: Niako_5026Help
Entry
Niako_5026        CDS       T01679                                 

Definition
(GenBank) UDP-glucuronate decarboxylase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
nko  Niastella koreensis
Pathway
nko00521  Streptomycin biosynthesis
nko00523  Polyketide sugar unit biosynthesis
nko00525  Acarbose and validamycin biosynthesis
nko01130  Biosynthesis of antibiotics
Module
nko_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Niako_5026
   01055 Biosynthesis of vancomycin group antibiotics
    Niako_5026
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Niako_5026
   00525 Acarbose and validamycin biosynthesis
    Niako_5026
Enzymes [BR:nko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Niako_5026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 adh_short NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AEW01265
UniProt: G8T8T5
Position
complement(6222164..6223150)
Genome map
AA seq 328 aa AA seqDB search
MSRKRVLITGAAGFLGSHLCDRFIKEGFHVIGMDNLITGDLRNIEHLFKLEQFEFYHHDV
SKFIHVPGDLHYILHFASPASPIDYLKIPIQTLKVGSLGTHNCLGLAKAKNARILVASTS
EIYGDPLVHPQNEEYWGNVNPVGPRGVYDEAKRFQEAMTMAYHSFHGVETRIVRIFNTYG
PRMRLNDGRALPAFIGQALRGEDLTVFGDGSQTRSFCFVDDLIEGIYRLLMSDYHQPVNI
GNPDEISLLEFAEEIIALTGTTQKIVHKPLPVDDPKQRQPDITRAKEILGWTPKVSRKEG
LKVTYDYFRSLSKDEWFKQPKEFQNAKS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaaaaagagtacttattaccggagcagcaggttttttagggtcacatttatgc
gaccggtttattaaggaaggtttccatgttattggcatggacaacctgattaccggcgac
ctgcgcaatattgaacatttattcaagctggaacagtttgagttttatcaccacgatgta
tcgaaattcattcatgttcccggcgacctgcattatatcttacactttgcttcaccagcc
agtcccatcgactacctgaaaattccaattcaaacgttgaaggtaggttcgttgggaacc
cataactgcctgggacttgccaaagcaaagaatgcccgcattctggtagcttctacttca
gaaatatatggcgatcccctggtgcacccgcaaaatgaagaatactggggtaatgtaaac
cctgttggaccgcgtggagtatacgacgaagcaaaacgttttcaggaggcaatgaccatg
gcgtatcattctttccatggcgttgaaacccgcatcgtacgcatcttcaatacctacgga
ccgcgtatgcggttgaacgacggccgtgcactgcctgcatttataggccaggcattacgt
ggtgaagacctgaccgtatttggcgatggttcacaaacccgcagcttttgctttgtagat
gatcttattgaaggaatataccggctgttaatgagcgattatcatcagcctgttaacata
ggcaatcctgatgaaatctcgctgctggaatttgccgaagagatcattgcactgaccgga
acaacacaaaagattgtacacaaaccattgcctgtcgatgatcccaaacaacggcagccg
gatattacccgggcaaaagaaatccttggctggacaccaaaagtgagcagaaaagaagga
ttgaaagtaacctacgattatttcagatcgttatcaaaagatgaatggtttaaacagcct
aaagagtttcaaaacgcaaaaagctaa

DBGET integrated database retrieval system