KEGG   Niastella koreensis: Niako_5027Help
Entry
Niako_5027        CDS       T01679                                 

Definition
(GenBank) nucleotide sugar dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
nko  Niastella koreensis
Pathway
nko00040  Pentose and glucuronate interconversions
nko00053  Ascorbate and aldarate metabolism
nko00520  Amino sugar and nucleotide sugar metabolism
nko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Niako_5027
   00053 Ascorbate and aldarate metabolism
    Niako_5027
   00520 Amino sugar and nucleotide sugar metabolism
    Niako_5027
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     Niako_5027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C NAD_binding_2 ApbA 3HCDH_N F420_oxidored NAD_Gly3P_dh_N Pyr_redox TrkA_N Pyr_redox_2 NAD_binding_7 AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEW01266
UniProt: G8T8T6
Position
complement(6223169..6224491)
Genome map
AA seq 440 aa AA seqDB search
MKIAVVGTGYVGLVTGTCFAETGNDVTCVDIDKKKVEKLSSGQITIYEPGLEKLFLRNVK
EERLRFTTSLAEGIRDAEIVFLALPTPPGEDGSADLKYILGVARDLGELMTDYKVIVDKS
TVPVGTAEKVYATIARSFVGDFDVVSNPEFLREGVAVEDFMKPDRVIIGTVSERARKVMG
ELYAPFVRSGNPVIYMDVRSAELTKYAANSFLATKISFMNEIAQLCERVGADVDMVRRGI
GSDDRIGKRFLFPGIGYGGSCFPKDVQALVQSSKEVEYDFQILNAVMDVNEKQKLHLLPK
VKRYFKNNLKGKRFALWGLAFKPNTDDIREAPALYIIDELVKEGAIVCAYDPEAVNNVRA
LLGDKIQYAENQYDCLVGADALIIATEWNEFRTPNFLKIVTALKHKVIFDGRNLFETDAI
KELGFYYESVGRSVADPAAK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgctgttgtaggcacgggctacgtaggcctggttaccggaacctgttttgca
gaaaccggtaatgatgttacctgcgtggatatcgataaaaaaaaggtagagaaactttct
tccggccagatcaccatctatgaacctggattggaaaaattgtttctgcgtaacgttaaa
gaagaacgcttacgctttaccaccagtttggctgaagggatcagagacgcggaaatcgtt
ttcctggcattaccaacaccgcccggtgaagatggaagcgccgatctgaaatacattctg
ggtgttgccagagacctgggcgaactgatgaccgattataaggtgattgtcgataaaagt
accgtgcctgtaggcacagcagaaaaagtatatgcaaccattgccaggagctttgtaggc
gattttgatgtggtgtcgaaccccgaattcctgcgggaaggggtagcagtggaagatttt
atgaaaccagaccgcgtgataataggcactgtttctgaaagggcccgcaaagtaatgggc
gaactgtatgcgccatttgtgcgttcgggcaaccctgttatctatatggatgttcgctcg
gccgagcttactaaatatgccgctaattccttcctggctaccaagatctcttttatgaac
gaaatagcccagttgtgcgaacgcgtgggcgcagatgtggatatggtacgccgcggtatt
ggcagcgacgatcgtattggaaaacgcttcctgttcccgggtatcgggtatgggggcagt
tgttttcccaaagatgtgcaggccctggttcaatcatctaaagaagtggaatacgatttc
cagatcctgaatgcggtaatggatgtgaatgaaaaacaaaagctgcacctgcttcccaag
gttaaaagatattttaagaataacctgaaaggaaaacgttttgccctgtggggactggcg
tttaaacctaatacggatgatattcgcgaagcaccggctttatatattattgatgaactg
gtaaaagagggcgccattgtttgtgcgtatgaccccgaggcagtgaacaatgtgcgtgca
ttattgggcgataaaattcaatatgccgaaaaccaatacgattgcctggtgggtgccgat
gcgttgatcattgccaccgagtggaatgagtttcgcacccctaacttcctgaagatcgta
actgcgcttaagcacaaagtgatcttcgatggacgcaacctgtttgaaacagacgccatt
aaagaattaggattttactacgaaagcgtgggccggtcagtagctgatccagctgctaaa
taa

DBGET integrated database retrieval system