KEGG   Niastella koreensis: Niako_5030Help
Entry
Niako_5030        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEW01269
UniProt: G8T8T9
Position
complement(6227227..6228090)
Genome map
AA seq 287 aa AA seqDB search
MERLAQLIGKLNEQFAQNADPFQLLVTAQLIETELVQMSTSTHRVVNSSKVAVVMPAANG
HGYQARKAAFQENPTPEVVNTPEAVAEPPVEVKAPVVEEAPVVVETPVVVEETPPVVVTP
VVVNGNGINGTVEKNSTHNGTNGNNGTNGHHHDAQTEYGWKIDPLREVPTLAHQQVVKEL
NEVMATKSSSLNEKLKEEVKEVAHVLNDAPVRDLRRAIGINDRFVFISELFRNDEVMYER
SIKTINSFRILPEAQYWIERELKVKLGWDENKESTRHFYQLVKRRFS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtttagcacaacttattggcaaattaaatgaacaatttgcacaaaacgccgat
ccgtttcaactattagtgactgcccaattaattgaaacagaattggtacagatgtcaacg
tccacacaccgggttgtaaattcatccaaagtggcggtggtaatgcctgcggctaatggt
catggctaccaggcccgtaaggcggcattccaggaaaatcccacgccagaagtagtaaat
acccccgaggcggttgcagaaccaccggttgaagtaaaggcgccggttgttgaggaagct
cccgttgttgtggaaacgccggttgtagtggaagaaacaccacccgtggtagttaccccg
gttgtggtgaatggcaacggcattaatggaactgtggaaaaaaatagtacccacaacggt
accaatggcaataatggtactaatggtcatcaccacgatgcccagactgaatacgggtgg
aaaattgatccgctgcgcgaagtccccactttagcgcatcaacaggttgttaaagaactg
aatgaagtgatggctaccaaaagctcttcccttaatgaaaagttaaaagaagaggtgaag
gaggtagctcatgtattgaacgatgcgccggtacgcgatctgcgccgggctatcggtatc
aatgatcgttttgtatttatcagcgaactcttccgcaacgacgaagtgatgtatgaacgc
agcataaaaaccatcaatagttttcgcatattgcccgaagcccagtactggatcgaacgc
gaattaaaagttaaactgggttgggacgaaaacaaggaaagcacccgccacttttatcag
ctggttaaaagacggttctcctga

DBGET integrated database retrieval system