KEGG   Niastella koreensis: Niako_5034Help
Entry
Niako_5034        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1980
Motif
Other DBs
NCBI-ProteinID: AEW01273
UniProt: G8T9S9
Position
6230239..6230460
Genome map
AA seq 73 aa AA seqDB search
MKQLIVTLIVLFVQLMARAQDSTKHVAQTPTGLAAGNKIYVVLVVAVTILAGLFLYVIRL
DRKISKLEKQSSL
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactaattgtaaccctgatcgttttatttgtccaattaatggcccgtgcccag
gactctacgaaacatgtagcgcaaacgccaacaggtttggccgccggcaacaagatctat
gttgtactggttgttgccgtaacaattctggcgggattgttcctgtatgtgatccggctc
gacagaaagatctcaaagctcgaaaaacaaagttctttataa

DBGET integrated database retrieval system