KEGG   Niastella koreensis: Niako_5035Help
Entry
Niako_5035        CDS       T01679                                 

Definition
(GenBank) Glutamate dehydrogenase (NAD(P)(+))
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
nko  Niastella koreensis
Pathway
nko00220  Arginine biosynthesis
nko00250  Alanine, aspartate and glutamate metabolism
nko00471  D-Glutamine and D-glutamate metabolism
nko00910  Nitrogen metabolism
nko01100  Metabolic pathways
nko01120  Microbial metabolism in diverse environments
nko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Niako_5035
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Niako_5035
   00220 Arginine biosynthesis
    Niako_5035
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Niako_5035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nko04147]
    Niako_5035
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     Niako_5035
Exosome [BR:nko04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Niako_5035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C NAD_binding_7 AdoHcyase_NAD Bac_GDH
Motif
Other DBs
NCBI-ProteinID: AEW01274
UniProt: G8T9T0
Position
6230582..6231991
Genome map
AA seq 469 aa AA seqDB search
MSDYSFFGAVEKSFDKAAQFTTWDPGILEQIKQCNAVYRMHFPVKIGDKIEVIKAYRVQH
SHHKFPCKGGIRFALSVNLDEVMALAALMTYKCAIVNVPFAGAKGGITIDPKKYTPYELE
KITRRYTSELIKKNFIGPGIDVPAPDYGTGEREMAWIVDTYTSMRPGEIDGLGCVTGKPV
TQGGVRGRREATGLGVFYGLREVLSMKEVMDKLGLPVGVEGKRVVVQGLGNVGYHTAKFF
QEHGAKIVGLSEYEGAIYNLDGLDVDKVVEHRKAKGTILNFPGSTNFTKNTDALEMDCDI
LIPAALEAVVNGQNAPNVKAKIIGEAANGPLTPEADEVFAKRGILVVPDMYLNAGGVTVS
YFEWLKNLSHVRYGRMEKRFTENLNTHILGQIEELTGKKVNGSEKELIMHGPDEVDLVRS
GLEETMITATREIMDVWKANPQIPDMRTAAYVVAINKVGTSYNELGIFP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattacagtttttttggcgcggtggagaagagtttcgataaagccgcgcaattc
accacctgggatcccggtatcctggaacagatcaaacaatgcaatgccgtttatcgcatg
cattttccggtaaaaattggcgataagatcgaagttatcaaagcttatcgcgttcaacac
tcccatcacaaatttccctgtaaaggcggtattcgttttgccctttcagtgaacctcgat
gaagtaatggcccttgccgcccttatgacctataaatgcgctatcgtaaacgttccgttt
gccggcgccaaaggcggtatcaccatcgaccccaaaaagtatacgccttatgagctggaa
aagatcacccggcgttatacttcagaactgattaaaaagaatttcataggccccggcatt
gacgtacccgcccccgattatggtaccggcgaacgtgaaatggcctggatcgttgatact
tacaccagtatgcgccccggcgaaattgacggactgggttgcgtaaccggtaaacctgtt
acccagggtggcgttcgcggccgtcgcgaggcaaccggcctgggtgtgttctacggttta
cgcgaagtactttccatgaaagaagtaatggataaactgggcttaccagttggtgtggaa
ggtaaacgtgttgttgtacagggattgggtaatgtgggttaccatactgccaaattcttc
caggaacatggcgccaaaatcgttggtttaagtgaatacgaaggcgctatttataacctc
gatggcctggatgtagacaaagttgttgaacaccgcaaagccaaaggtactatcctgaat
ttcccgggaagcaccaactttacaaaaaataccgatgcacttgaaatggattgcgatatc
ctgatccctgctgcactggaagccgtggtgaatggtcagaacgcgcctaatgtaaaagca
aagatcattggtgaagctgccaacggaccacttacacccgaagcggatgaagtgtttgca
aaaagaggcatcctggtagtaccggatatgtatctcaatgccggcggggtaaccgtatcg
tactttgaatggttaaagaacctcagccatgtgcgttatggccgcatggaaaaacgcttt
accgagaacctaaatacccatatccttggccaaattgaagaactgaccggcaaaaaggta
aatggttcagaaaaagaattgatcatgcacggtcccgatgaggttgacctggtacgcagt
ggtttggaagaaaccatgattaccgctacccgcgagatcatggatgtatggaaagccaat
ccgcaaattcctgatatgcgtacagccgcctacgtggtagccatcaataaagttggaacc
agttataatgagctgggtatattcccatag

DBGET integrated database retrieval system