KEGG   Niastella koreensis: Niako_5037Help
Entry
Niako_5037        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSDR_N_2 YhcG_C
Motif
Other DBs
NCBI-ProteinID: AEW01276
UniProt: G8T9T2
Position
complement(6234475..6234939)
Genome map
AA seq 154 aa AA seqDB search
MVNSSFDNMIRIEYPLFPFRMKREEGKEFIFDECRRQWIRLTSEEWVRQNFLQYLLQTKK
YPAALIAVEKEIRLGELKKRFDILIYNQQHQPWLMVECKAMEVPIQDEVLHQVLRYNIAV
PVPYLVITNGAASFAYIRKNNQLQMLDDLPEYGI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatagtagctttgacaatatgatcaggattgaatatcctttgttcccttttcgc
atgaaacgggaagaagggaaagaatttatttttgatgaatgccgccgtcaatggatccgc
ctgacttcggaagaatgggttcgtcagaattttctgcaatatttattacaaaccaagaag
tatcccgctgccctgatcgctgttgaaaaagagatcaggctgggagagctgaagaaacgg
tttgatatacttatatacaatcaacagcaccaaccctggctgatggtggagtgtaaggcg
atggaagtgcccatacaggatgaggtattgcaccaggtattgcggtataacatagccgta
cccgtgccctaccttgtaattaccaatggtgcagccagttttgcttatattaggaaaaac
aaccagctgcaaatgcttgatgatttgccggagtacggaatttaa

DBGET integrated database retrieval system