KEGG   Niastella koreensis: Niako_5038Help
Entry
Niako_5038        CDS       T01679                                 

Definition
(GenBank) AMP nucleosidase
  KO
K01241  AMP nucleosidase [EC:3.2.2.4]
Organism
nko  Niastella koreensis
Pathway
nko00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Niako_5038
Enzymes [BR:nko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.4  AMP nucleosidase
     Niako_5038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1 DUF190
Motif
Other DBs
NCBI-ProteinID: AEW01277
UniProt: G8T9T3
Position
6234995..6235765
Genome map
AA seq 256 aa AA seqDB search
MKTKDEIVKNWLPRYTGETLDHFGEYILLTNFSNYVKMFAEWNNVPVTGIDRPMQCATAE
NITIVNFGMGSPTAATVMDLLTAIEPKAVLFLGKCGGLKKRNNIGDLILPIAAIRGEGTS
NDYFPPEVPALPAFALQKAVSTTIRDYSVDYWTGTVYTTNRRVWEHDEHFKEYLQKIRAM
AIDMETATIFSVGFYNKIPTGALLLVSDQPMVPEGVKTEESDKKVTANFVERHVRIGIDS
LKQLINDGLTVRHLRF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaagatgaaatagtaaagaactggctgccccgttacaccggagaaaccctc
gaccattttggtgaatacattctgctcaccaacttcagcaattatgtaaagatgtttgcc
gaatggaacaacgtaccggttacgggcatcgacaggcccatgcaatgcgccactgccgaa
aacattaccatcgtcaactttggcatgggcagccctacagctgctaccgtaatggacctg
ttaacagctattgaacccaaggccgtgctgttcctgggtaaatgcggcgggttgaaaaaa
cgcaacaatatcggcgatcttattttacccatcgcagccattcgtggcgagggtacttcc
aacgactacttcccgcccgaagtacctgccctgcccgcattcgccctgcaaaaagcggtg
tctactactattcgcgattacagcgttgactactggaccggcaccgtgtatactaccaac
cgccgggtatgggagcacgatgagcactttaaagagtacctgcaaaagatacgggccatg
gccatcgatatggaaacagccaccatcttttctgtaggtttctataacaaaattccaacc
ggcgctttattgctggtaagcgatcagcccatggtacccgaaggcgtaaaaaccgaagaa
agcgacaaaaaggtcaccgccaattttgttgaacggcatgttcgtatcggaattgattct
ctgaaacaattaatcaacgacgggttaaccgtgagacatttgagattctga

DBGET integrated database retrieval system