KEGG   Niastella koreensis: Niako_5039Help
Entry
Niako_5039        CDS       T01679                                 

Definition
(GenBank) peptidase M14 carboxypeptidase A
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M14
Motif
Other DBs
NCBI-ProteinID: AEW01278
UniProt: G8T9T4
Position
complement(6235877..6237604)
Genome map
AA seq 575 aa AA seqDB search
MRILSVLFLFLLPAFIFSQSITTKYEQSQAKETPTYSEIISWWQMMDTRFPTIKMQTMGP
SDAGFPLHLVIVSTDGDFDLASLHRKNKRIILVNNGIHPGEPDGIDASMLLVRDIATHKI
KLPDNVVLAIIPVYNIGGCLNRSPYYRVDQNGPAEFGSRGNSQNLDLNRDFIKCDSKEAR
SFAAIFHLCDPDVFVDNHVSNGADYQHIMTLLTSQYNKLGGPMGDYLHTQFEPGLYKLMK
EKGYDLVPYVDFAGQTPESGMEAYFDGPRYSSGYATLWHTFAFVPETHMLKPYNQRVEAT
KALMESFIAFTATNSTTIHQLREQTKKAVSSQTSFPVSWKLDTTKTDLVTFKGYESGHKP
SEVSGLPRLYYDRSKPYEKQIKYYNTYAARTTIEKPLAYIIPQGWWPVIDLLKLNKVNMQ
VLAKDTEMMVETYLIEDYKPYPRQYEMHHLNTNVVVNAATLPIKFRKGDYYIQLNQPANR
FLMEVLEPQADDSYFAWNYFDAVLGRKEGYSAYAFEDIAAQYLTDHPNVKKELETRRSTD
TAFAKSASAQLDFVYHNSPYYEPDHMRYPVYRVVR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagaatactatcagtactcttcctgtttttattgccggcatttattttcagccaatcc
attacaactaaatacgagcaatcccaggccaaagaaacgcccacctacagcgagatcatc
agctggtggcaaatgatggacacccggttccccaccataaaaatgcaaactatgggaccc
agcgatgccggttttcccctgcacctggtgatagtgtcgaccgacggtgattttgatctg
gccagcctgcaccggaaaaataaacgcatcatcctggtaaataatggcattcaccccggc
gagccggatggcatcgatgccagcatgctgctggtgcgggatattgccacccacaaaata
aaactgcccgataatgtggtgctggccattataccggtttataatattggtggttgtttg
aatcgcagcccctactatcgcgtagaccaaaacggaccggcggaattcggttcccgtggt
aattctcaaaatctggatctcaatcgcgactttataaaatgcgattccaaagaagcccgc
tcctttgcggctatctttcacctgtgcgaccccgatgtgtttgttgataaccacgtaagc
aacggcgccgattaccagcacattatgactctgcttaccagtcagtataacaaactgggc
gggcccatgggcgattacctgcatacgcagtttgaaccgggactgtacaagctgatgaaa
gaaaagggctatgacctggtgccctatgttgattttgccggccaaacgccggagtcgggc
atggaggcttactttgatggcccgcgctatagcagcggttacgccactttgtggcacacc
tttgcctttgtacccgaaactcatatgctgaaaccatataaccagcgggtggaagcgacc
aaagccctgatggaatcgttcatcgctttcacggccaccaacagtactaccattcaccaa
ttgcgggaacaaactaaaaaggccgtatcaagccaaaccagttttccggtgagctggaaa
ctcgatactactaaaactgatctggtaacgttcaaaggttatgagtccggacataaaccg
agtgaagtatccgggctgccgcgtttgtattacgatcgcagcaagccgtacgaaaaacag
attaagtactataatacttacgctgcccgcactacgatcgaaaaaccgcttgcctatatt
attccccagggctggtggccggtgatcgatctgttaaaacttaataaagtgaatatgcag
gtattggcaaaggataccgagatgatggtagaaacgtatcttattgaagattacaaacct
tacccccggcagtatgaaatgcatcatttgaatacaaatgtggtggtgaacgccgccacg
ctgccgataaaattcagaaaaggagattattatattcagctcaatcaaccagccaaccgg
tttttgatggaagtgctggaaccgcaggccgatgattcttactttgcctggaattatttt
gatgctgtcctgggccggaaggaaggatatagcgcttatgcatttgaagatatagcggcg
caataccttactgatcatcccaatgtaaaaaaggagctggaaacacgcaggtcaactgat
acagcctttgccaaaagcgccagcgcccagcttgactttgtttatcataattcaccttac
tacgaacccgatcatatgcggtatccggtttatagagtagttcgttag

DBGET integrated database retrieval system