KEGG   Niastella koreensis: Niako_5053Help
Entry
Niako_5053        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSII_BNR SusE
Motif
Other DBs
NCBI-ProteinID: AEW01292
UniProt: G8T9U8
Position
complement(6256425..6258749)
Genome map
AA seq 774 aa AA seqDB search
MKTIFYKKLQAFACLMVILLSSLVTTGQWTSVNTGAPGTAFLAGVQFIDANTGWFVGQNG
LIRKTTDGGTSWTTQASGTTNQFYSLKFVNSTTGWAAGVGGIIRKTADGTTWTSQTSGVT
SDLYRSDFLDVNTGWIVGKSGVIRKTVNGGTNWNAQTSGVTTDLYDIKFTDANTGWTVGA
NGVIRKTTNAGGTWTAQTSGTSQTLYSIFMLNSTTGWAAGTTGTILKTTNGGTTWTVQTT
PTTDPLFCIWFSSANNGFAIGNNGTIMITQDGGTTWGYQTSNNGVIMYTIFMLSSTQGWI
VGDNGTMLKTINAGGYTWTALNSGSTTITWRDIFFTNTSTGWICGDGGNIRKSTNSGNTW
TSQSSGTTNNLWSLQFVNASSGWAIGASGTICTTSNGGTNWATQTSGTSNTLHGVYMQSI
SLGWAAGDNGTILKYNGTSWSALPSGVTNNLYDVQFIDANTGWAVGFGGTILKTTNGGSS
WTAQSSGTTTNLLGSYFVDANTGFVVGENGVMRKTINGGSTWTSLGSGTTNHLNDVMFVD
ANNGYTVGVNKTIRYTADGGVTWTTQASSNPSEIRSVYFVNSNMGWTVGLNGEVQTYLLV
TLPLHISSIEAASTDCSTARLQWQTTGDAAADRYEVEWSADGNNWQNIGVVKATASPSHS
FTYGGLISGNNLFRLKLVENNGSFMYSKLLTVSANCLATATVATYPNPTHGAVILSLKDA
SLVGTTARLVSSQGHILKQFTINSVKEVLYLTGLPNGTYFLTTANKQSCRIIKQ
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatattttataagaagctccaggcatttgcatgcctgatggtaatcctttta
tcatccctggtcactacaggccaatggacatctgtaaataccggcgctcccggaaccgcc
tttctggccggcgttcaatttattgacgctaacacaggctggtttgttggtcaaaacggt
cttattcgtaaaaccaccgatgggggcacaagctggacaacccaggcctccggtacaacc
aaccagttttacagcctcaaatttgtcaatagtaccacaggttgggctgcaggtgtgggc
ggcattatacgtaaaaccgcagacggcactacctggacctcccaaacaagtggtgtaacc
tctgacctgtacagaagtgatttcctggatgtaaatacgggctggatagttggtaaaagc
ggtgttattcgtaaaaccgttaatggtggtaccaactggaatgcgcagacaagtggtgta
actactgacctgtacgatataaaatttaccgatgccaataccggctggacggtaggcgcg
aatggcgttatccgtaaaactaccaacgcagggggtacctggaccgcccaaacaagcggt
acctcgcaaacattatacagcatttttatgctgaattccactaccggctgggctgcaggt
actacaggtaccattttaaaaaccaccaatggcggtactacctggacggttcaaaccacg
cctactaccgaccccctgttttgtatatggttcagcagcgccaacaacgggtttgccatt
ggtaacaatggaaccattatgattacgcaggacggtggtactacgtggggctatcaaacc
agcaataatggcgtgatcatgtacaccattttcatgttaagcagcacccagggctggata
gttggcgataatggcaccatgttgaaaacgatcaatgccggtggttatacctggacggcg
ctaaacagcggttctactacaataacctggcgtgatatattttttacaaatacttccacc
ggctggatctgcggcgatggcgggaatattcgtaaatcaaccaacagtggtaacacctgg
acctcgcaaagcagcggtactactaataatctttggagtttgcagtttgtaaatgccagt
tcaggatgggctataggtgcatccggaaccatttgtacaacttccaatggcggcactaac
tgggctacccaaaccagcggtacttcaaatacattacatggtgtatatatgcaaagtatt
tccctcggttgggcggccggggacaatggcaccattcttaaatacaatggtaccagttgg
tcagcactgccttccggtgtcaccaataatctatacgatgtacaatttattgatgccaat
accggctgggcggtgggctttggtggtaccattttaaaaaccaccaatggcggttccagc
tggaccgctcaaagtagcggcacaactaccaacctgttgggctcttattttgttgatgcc
aacaccgggtttgttgtaggggagaatggtgttatgcgtaaaaccatcaatggcggttct
acctggaccagcctcggcagcggtaccaccaatcatttgaatgatgttatgttcgtagat
gcgaacaatggctacacggtaggcgttaacaaaacgatcaggtatacagctgatggcggc
gttacctggaccacccaggcaagctcaaaccccagcgagatcagaagtgtatacttcgta
aatagcaatatgggctggacggttggtcttaatggtgaagtacaaacctatttgctcgtg
accctgccactccatatcagttctatcgaagctgccagtacggattgtagtactgcccgg
ttgcaatggcaaactaccggtgatgccgctgccgacaggtatgaagtagaatggtctgcc
gatggtaataactggcaaaatattggcgttgtaaaggcaacggcgtcaccatcccactca
ttcacgtatggtggcctgatatcaggtaataacctgttcaggttgaaactggttgaaaac
aatggcagctttatgtattcgaagttgttaacggtttcggctaattgtttggctacagcc
accgttgctacataccctaacccaactcatggcgcagtgatcctttcattgaaggatgca
tcccttgtgggtactacagcccggttggttagttcgcaggggcatatcctgaaacagttt
accattaacagcgtgaaagaggttttgtatttaaccgggttaccaaatggtacctatttc
ctgacgacagccaataagcaatcatgcaggatcataaaacaataa

DBGET integrated database retrieval system