KEGG   Niastella koreensis: Niako_5057Help
Entry
Niako_5057        CDS       T01679                                 

Definition
(GenBank) GumN family protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraB
Motif
Other DBs
NCBI-ProteinID: AEW01296
UniProt: G8T9V2
Position
6263229..6267128
Genome map
AA seq 1299 aa AA seqDB search
MLPVLLLAIFLPSMAQQPAHKPKTAAPLPPHPTPVVPKPGPKKYPSLLWEISGNGLKKPS
YLFGTMHVSDKLAFHLGDSFYTAIKSADVVALETNPESWQDDYSQSVFFRGSNNRRGGAS
LANLYAANRWEWPADHMRITTFAIDRYEESIKAALAVEPSMINGMLYRTDGQRAEDFEED
TFLDMYIFQTGKKLGKRVSGVENFQESEKLVMEAYKAMLRDQNKKRRSYDYEGMMTNPKK
VEDAYRKGDLDLLDSLESLTVFSDAFQEKFLYKRNEIQANSIDSIIRKMSLFVGVGAAHL
PGKRGVIELLRQKGYTMRPVRMDDRNSLQKESVDKIRINSPFTTQTCDDGFYTVSIPGKK
FYRFTDWNGLDVVQYADMVNGAYYMVTRIKTNSLSWEHSSDLVLKKVDSLLYENIPGKIT
KKTSITKNGYKGLDVINRTRRGDNQHYQIFVTPFEVILFKMSGNGEYVVSGNEAQDFFGS
IRLKEYTSTGWQTWQPPTGGFSVQMPHTPALLKDNSFGTDRLEYAAYDAASDNSYLIMKA
NLHNYSFIEEDSFELNLMDESYGYSDFIDKELSHHFTTVNGYPALESKFKHKDGSFSSVK
YVIQGPIYYAVIASYKTDNPNTQRFLQSFSITPFIYPAPTPRTDTTLYVTVTSPIYSKPD
KKDESAGMEELLQLSNGGGADDDPDDYNLPTFGTRLISNDTIGEKILVMHFKVPPYAYKK
DSTKLWKNAAVSSWFNDSTFIIKQNKLYRLPNGMQCRDIQLTDTNSSRLIIAKLFYNNGH
FFSISTLTDTLTKQSALLSNFFSSFKPIDTLKGESLFTRKTDRFMKDLFSRDSLAVKRAR
KSLYQVGFDSLDVPLLKKAIDSLNWKMKDYLVLKRYFIESLGRLKDSSITTYLQKLYWKV
KDTADWQSAILNALLNQRTKTSFIAFKDLVLQEPPITDDDYSYSRSSRISSVTVDIAPAP
HSSSKSSYYGHWAPLFDTLALTKELFPDMLQLMNIDDYEDEMMNLLETMVDSGYLKAADY
ETSFPKLYLEAKQLLKKQLAKENKVKMEIALRKESPVASSYASDDDGDDAVSDAGNKELD
RYAILLLPFYDKNQGVKSFFEQLQTTQDRRLRYNTFILLLRNKFKVPDSLFTQYAKEDLY
RSELYSDLQTLKMLDKFPKQYKTQLEITRSLIAKPLDNYNKLDTIIYLDKLLVAYDNKKG
YVYFFKYKRMRDDITWNVATVGMQPEKQDAVDVENDDFTSVEEDRRLDNDKPVKEQLQKM
LKEMLYARRGSASVFYDARSFSLYRNYLSEMVKSQRYRD
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcctgtcctgttgttggctatttttttgccatccatggcgcaacagccagcccac
aaacctaaaaccgccgcgcccctgccaccccatccaacgcccgttgttcccaaaccaggc
cccaaaaaatatcccagcctgttgtgggagatcagtggtaatggtcttaaaaagccatcg
tacctgttcggcactatgcacgtaagcgataaactggcctttcacctgggtgattcgttc
tacacagccatcaaaagcgccgatgtagtggcgctggaaaccaatcccgaaagctggcag
gacgattacagtcaatctgttttttttcgcggcagcaacaaccgccgcggcggcgccagc
ctggccaacctgtatgccgccaaccgctgggagtggccggcagaccatatgcgcatcacc
accttcgccattgaccggtatgaagaatctataaaagccgccctggctgtggagccctcc
atgataaatggcatgctgtaccgaacggatggccaaagggccgaagattttgaggaagac
accttcctcgatatgtatatttttcaaaccggtaaaaaactgggcaaacgcgtaagtggc
gtagagaacttccaggaaagcgaaaagctggtgatggaagcttacaaagccatgctgcgc
gaccagaacaaaaaaagaagaagctacgattatgagggcatgatgaccaaccccaagaaa
gtggaagacgcctaccgcaagggcgatctagacctgctggactcactggaaagcctcacc
gttttctccgatgccttccaggagaaatttctatataaacgcaacgaaatacaggccaac
tctattgactccatcatccggaaaatgtcgttgtttgtaggcgtgggggccgcccactta
cccggcaaacgcggcgtaattgaattattgcgacaaaaaggctacaccatgcgccctgtt
cgcatggatgaccgcaacagcctgcaaaaagaaagcgttgacaagatcaggatcaattct
cccttcaccacccaaacctgcgacgatggattctacaccgtttccatccccggcaaaaaa
ttctatcgctttaccgactggaatgggctcgatgttgttcagtatgccgacatggtgaac
ggcgcctattatatggttacccgcataaaaaccaacagcctttcgtgggaacatagcagt
gacctggtgcttaaaaaggttgacagcctgctttatgaaaacattcccggcaagatcacg
aagaaaacatccattactaaaaacggctacaaggggctcgacgtgatcaatcgcacccgc
cgtggcgacaaccagcattaccagatctttgttaccccatttgaggttattctttttaaa
atgagcggcaatggcgaatacgtggtcagtggcaacgaagcccaggacttctttggttct
atacgcctgaaagaatatacctccaccggctggcaaacctggcaaccacccacaggcggt
ttcagcgtgcaaatgccccacacgcctgccctgttaaaagacaacagctttggtaccgac
aggctggaatatgcggcttacgatgcagcaagcgacaatagctacctcattatgaaagcc
aacctgcacaactattcatttattgaagaagacagttttgagctgaacctgatggatgaa
agctatggttattctgatttcatcgataaagaattgagccaccattttacaactgtaaac
ggctacccggccctggaaagtaaattcaaacacaaagacggaagtttcagcagcgtaaaa
tatgtgatccagggacccatctattatgccgttattgccagttataaaaccgataatccc
aatacccagcgttttctgcaatcattttccataacgccctttatttacccggcccctacc
ccacgtaccgataccacgctgtacgtaaccgttacttctcccatttattcaaagcccgac
aaaaaagatgagtcggccggcatggaagaattgttgcagttatctaatggtgggggagct
gatgatgacccggacgattacaacctccccacctttggcacccgcctcataagcaacgat
accatcggagaaaagatcctggtgatgcatttcaaagtgccgccgtacgcttataaaaaa
gacagtaccaaattgtggaagaacgcagccgtaagcagctggttcaacgacagtacgttc
attataaaacaaaacaaactataccggttgcccaatggcatgcagtgccgcgatattcaa
ttaaccgataccaacagcagccggctgatcattgccaaactgttttacaacaacgggcat
ttcttcagcatctccaccttaaccgatacgcttaccaaacaaagcgccttactttccaac
ttcttcagcagctttaaaccaatagataccctcaaaggcgaatcgctgtttaccaggaag
accgacaggtttatgaaagacctgttcagcagggattcactggccgtaaaacgggcgcgt
aaatcactttaccaggtagggttcgattcgctggatgtgcccttgctaaaaaaggccatt
gattcgctgaactggaaaatgaaagactacctggtgctgaaaagatatttcattgaaagc
ctgggcaggttaaaagactcaagcattactacctacctgcaaaaattatactggaaggta
aaagacacggcagactggcaatcggccatcctgaacgccttgctgaaccagcgaaccaaa
acctcattcatcgcatttaaagacctggtattacaggaaccgccgatcacggacgatgac
tactcttattcacgttcgtcccggataagttcggttacggttgatattgccccggcacca
cacagcagcagtaagagcagctactatggccattgggcgcccctgttcgataccctggcg
cttacaaaagagttgttccccgacatgctgcagttaatgaatatcgacgactatgaagat
gaaatgatgaacctgctggaaacaatggttgacagtggttatttaaaggcggcggattat
gaaaccagctttccaaaactctacctcgaggccaaacaattgctgaaaaaacaactggcc
aaagagaacaaggtcaaaatggaaatcgccctccgtaaagagtcgcccgttgcatcgtca
tatgccagcgacgacgatggtgacgatgccgtttccgatgccggcaataaagagcttgac
cggtatgccatcctgttattaccgttctatgataaaaaccagggtgtaaaaagctttttt
gaacaactgcagaccacgcaggacaggcgattgcgttataacaccttcatcctgttattg
cggaacaagttcaaggtgccggattcgctgttcacccaatatgcaaaagaagatctgtat
cgcagtgaattgtacagcgatcttcaaaccctgaaaatgcttgacaaatttcccaaacaa
tacaaaacccagctggaaattacgcgcagcctgatcgctaaaccgctcgacaattacaac
aagctggatacaatcatctacctcgataaactactggtagcctatgacaacaaaaagggc
tatgtatatttctttaaatacaaacgcatgcgcgacgatattacctggaatgtagccact
gtaggcatgcaacccgaaaaacaggatgccgttgatgtagagaacgacgacttcacttct
gtagaagaagaccgcaggctcgacaacgacaaacccgttaaagaacagttgcagaaaatg
ttgaaggaaatgttatatgcccgccgcggaagcgcatcagtattttatgatgcccggtcg
tttagtttgtacaggaattatttgtcggaaatggttaagagtcaacggtacagggattag

DBGET integrated database retrieval system