KEGG   Niastella koreensis: Niako_5058Help
Entry
Niako_5058        CDS       T01679                                 

Definition
(GenBank) protein of unknown function DUF1415
  KO
K09941  uncharacterized protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1415
Motif
Other DBs
NCBI-ProteinID: AEW01297
UniProt: G8T9V3
Position
6267237..6267779
Genome map
AA seq 180 aa AA seqDB search
MSTDQQIIEQTKKWIQSVVIGLNFCPFANREFKNNTIHYQVEHGVTRTDARNALLKECKR
LDKEKSIATTLLIFPGYFTEFDSYLQFVSFAEKLLQQKGYEGVYQLATFHPQYKFEDSAT
DDAANYTNRSIYPMLHLLREDQVRKAIQFYGNADEIPLKNIQLAREKGTIYMKLLRDSCL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccgatcagcaaatcattgaacaaacaaaaaaatggatccaatctgtagtaata
gggttaaacttctgtccgtttgcgaaccgggagtttaaaaacaataccatccattaccag
gtagaacatggagtaacccgcaccgatgctcgcaatgctttgctgaaagaatgcaaacgg
ttggataaagaaaaatccattgccaccaccctgctgatcttccccggttattttactgaa
tttgacagctacctgcaatttgtttcatttgccgaaaaactgttacagcaaaaagggtac
gaaggcgtttaccagctggctacctttcatccgcaatacaagtttgaggacagcgccacc
gacgatgccgctaattacaccaaccgctcaatataccctatgctgcatttgttacgggaa
gaccaggtgcgcaaagccattcagttttatggcaatgccgatgaaatacctttaaagaat
atccaactggcaagagaaaagggaacgatatatatgaaattattacgggatagttgcctg
taa

DBGET integrated database retrieval system