KEGG   Niastella koreensis: Niako_5059Help
Entry
Niako_5059        CDS       T01679                                 

Definition
(GenBank) Nickel-transporting ATPase., Sulfate-transporting ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
nko  Niastella koreensis
Pathway
nko02024  Quorum sensing
Module
nko_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:nko00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Niako_5059
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nko02000]
    Niako_5059
Transporters [BR:nko02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Niako_5059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N oligo_HPY AAA_21 AAA_22 AAA_16 RsgA_GTPase Mg_chelatase AAA AAA_29 AAA_5 ATP-synt_ab TniB PRK AAA_7 AAA_33 AAA_24 DUF87
Motif
Other DBs
NCBI-ProteinID: AEW01298
UniProt: G8T9V4
Position
complement(6267871..6269598)
Genome map
AA seq 575 aa AA seqDB search
MSSPLLQINNLQVDFVTEIGTTTAVKDISITVNRGEIVAIVGESGSGKSVTSLSILQLLP
KASARYPQGDIRFSAGEGEPVNLLTQTPEQMRSIRGNQIAMIFQEPMTSLNPVFTCGHQV
QEALRLHLKIGKKEAREKTIELFNRVKLPNPGQLFRRYPHQVSGGQKQRVMIAMAMSCEP
SLLICDEPTTALDVTVQKTILQLIKELQQTQQMGVIFITHDLGVVAEVADRAVVMYRGEI
VESGTVASIFTNPRHPYTKGLLACRPVLHPKGERLPVVSDFLENNRPFDISRYTQVVEPP
VELKEPDTTVKQPFIQVSRLNVWFPSKTNLFGKPVDYVKAIDNIRFEIYKGETLGLVGES
GCGKTTLGRTLLGLIQPTSGSVRYDGTDLAKVDAQTMKEMRKDIQIIFQDPYSSLNPRLT
IGAAIAEPLKVHNIISSPAQRKDRVVELLEKVNLKAEHFNRYPHEFSGGQRQRIVIARAL
ALKPDFIVCDESVSALDVSVQAQVLNLLNDLKAEMGFTIVFISHDLSVVRYISDRIMVMN
KGKIEEIGDAEQVYFHPQKEYTKQLISSIPKGLIS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaccgctactccaaataaataacctgcaggttgattttgtaacagaaatcggc
accaccaccgccgtaaaggatatctctattaccgtgaaccgcggtgaaattgtggctatt
gtgggcgaatcgggttccggtaaatcggttacttccctgtcgatcttacagctgttacct
aaggcctcggccaggtacccccagggtgacattcggttttctgcaggtgagggggagccg
gtaaacctgcttacgcaaacgcctgaacaaatgcgttccattcgcggcaaccagatcgcc
atgatcttccaggaacccatgacttccctgaacccggtatttacctgtggtcaccaggtg
caggaagccttgcggttgcatttgaagatcggcaagaaggaagcccgggagaaaacgata
gaacttttcaaccgggtaaagctgcctaaccccgggcaattgttccgccggtatccgcat
caggtaagtggcgggcaaaaacaacgcgtgatgattgccatggccatgagttgtgaacct
tcgttgctgatctgtgatgaacccaccacggccctggatgttacggtacaaaagaccatt
cttcaactgataaaagaattacagcagacccagcagatgggcgtgatattcattacgcac
gacctgggtgtggtagccgaagtggctgaccgcgccgtggtaatgtaccgcggtgaaatt
gtggaaagcggaactgttgccagtatcttcaccaatccacggcacccttatacaaaagga
ctgctggcctgccggccggtgctgcatcccaaaggggaacgtttgccggtagttagtgat
ttcctggaaaataaccgcccgtttgatataagccgttatacccaggtagttgaaccgccg
gttgaattaaaagaacccgataccaccgtaaaacaaccttttattcaggtatcgcgattg
aatgtatggttcccttccaaaacaaacctgtttggtaaaccggttgattatgtaaaggcc
atcgacaacatccggtttgaaatctacaagggcgaaacgctggggttggtaggcgagtcg
ggctgtggtaaaacaacgcttggcagaaccctgctgggattgatccagcctacttccggt
tctgttcgttatgatggcactgatctggcaaaggtagatgcccaaaccatgaaggaaatg
cgcaaagacatccagatcattttccaggatccctattcctcgttgaatccgcgcttaact
ataggcgctgctattgccgaacctttgaaagtacataatattatttccagccctgcacaa
cggaaagacagggtagtggaactgctggaaaaagtaaacctgaaagcagaacattttaac
cgctacccgcatgagttttccgggggccaacggcagcgtattgtaattgcccgggcgctg
gcgctaaagcctgattttattgtttgtgatgaatcggtttctgcgctggatgtgagcgta
caggcgcaggtattaaacctgttgaacgacctgaaagctgaaatgggttttaccattgtt
tttatctcgcacgacctgtcggtggtgcgttatatcagtgaccgcattatggtgatgaat
aaaggaaagatcgaagagattggtgatgcggagcaggtgtactttcaccctcagaaagag
tatacgaaacaattgatctcatctattcccaaggggcttattagttaa

DBGET integrated database retrieval system