KEGG   Niastella koreensis: Niako_5060Help
Entry
Niako_5060        CDS       T01679                                 

Definition
(GenBank) alpha-2-macroglobulin domain protein
  KO
K06894  uncharacterized protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: A2M_N_2 MG1 A2M_N A2M Thiol-ester_cl Big_5 RcpC
Motif
Other DBs
NCBI-ProteinID: AEW01299
UniProt: G8T9V5
Position
complement(6269723..6275143)
Genome map
AA seq 1806 aa AA seqDB search
MRKQLIALITIGVCVLSMIAACNRSAVSLSYTNAKGEVQSLGNLVFRFDKSLVPDSLLNN
WDSTEYISFEPKIAGRFRWEHPDELVFSPAQPLSPATSYKAKLSGDLLDHSKYGKLDKGE
EINFFTPYLQLDNTNVTWMLPDQHSTTAYPQVDLYFNYAISPATIKDKMNLVVDGKPLKY
SIITEGPDSRISLRLAGVKMEDKDLEAKVTFEKGLVPDGGVNGTKDAIENKVFIPSPYNL
TINDVHAEHDGLTGTVFVRTSQQVVMSNLASLIRFEPAVKFSVQQTEDGFTISSENFDAD
KSYVLNINKGVSGRIGGTLHEPYSNNVVFGELEPSLSFANSKAVYLSALGNQNIEVRLTN
VPKVKVIISKIYESNLLMAQRYGYSPKDSRGEGEGEDGEYYGGDYEDNSDLALGDVIYEQ
EIDTRSLPKYGNSHLFTFNVEDKLPDFKGIYHIKLRSAKDYWVSDSRFISKSDIGLIARE
GKDKLFVFANSIKTAQPVNGMNVVVYGNNNQVLGTGATNTDGVAEVALSRKEFAGFKPAM
IIAKTANDFNYLPFNSTRVNTSRFDVGGKHSNTTGLDAFIYAERDIYRPGEKVNFSVILR
DRQWKSPGELPVKMKFLLPNGKELKNFRKTLNPQGATDGDVDISEAAITGSYTLEVYTSN
DVLLGSKNFSIEEFVPDRIKVTAKLDKPYLEPAQSAHLAITAVNFFGPPAANRNYEAEVQ
TSVINFDPKKYDTYNFSIENQGLSFDKVVKEGSTDDNGNASVEYEAPALFANKGLLQTTF
YATVFDETGRPVSRSTTANIYTQKMFFGIGSDGYWYYPLNQTVNFPLIALDKDEHVLNGA
RASVKVIKHEYRTVISKSGSYFKYESQKDDKVVAEQNITISGDKSTFPFVPRSPGDYELQ
VAIPGSESYVSKSFYSYGFWGGENSSFEVNTEGNIDIEADKSSYEAGENAKLLFKTPFDG
RMLVTLETDKVVSYQYVNVDKRSASVDLKMTADHLPNVYVTATLIKPHDVSEMPLTVAHG
YKSLKVEEKSRKINVEIVAQKSVRSRTHQKVTVKAAPNSFVTLAAVDNGVLQITDFKTPD
PYNHFYAAKALEVNGYDLYPLLFPELKATLSSTGGDGELEMSKRTNPMPAKRFKIVSYWS
GSTKTGGSGEAEFEFDIPQFSGEVRLMAVAYKDESFGSGETAMTVADPLVLSTALPRFLS
PGDTVTVPVTITNTTKGSTSATATLNVSGPLNVLGDKQQTVSLNSNSEGQAIFQLVASPA
VSTGKVRVDVQGLGEKFTDETEISVRPASPLQVVTGSGSFTGGNAQHLNIPLNDFLPNST
DYQLVVSRSPALELGKQLRYLVSYPYGCTEQTVSTAFPQLYIGDLADQLHTVEGGKSIAN
YNVQEAIRKIKLRQLYNGAVTLWDGEGTEDWWATIYAAHFLLEAQKAGFEVDKNVLNGIL
NYMNNKLKNKETILYYYNKDQKKKIAPKEIAYSLYVLALAGKPNVSAMNYYKANPMLLSL
DCKYLLSVAYAIAGDKAKFKELLPSSFTGEVSVAQTGGSYYSDIRDESIALNALLDVDPS
NTQIPVMAKHVADKMKQRYWYSTQECAFSFLSLGKMARAASKATVSADVKVNGKTVGSVS
NSPLKLTAKQLGGTNIDLTSKGEGRLYYYWQSEGISVSGAYKEEDSYIKVRRRFFDRYGR
VIDGNTFTQNDLVVVQITLEKSYSGDVDNIVISDILPAGFEIENPRTKEIPGMEWIKDAA
TPTALDVRDDRINLFDNLGSSRKTYYYAVRAVSPGNYRMGPVSAEAMYNGEYHSYNGGGV
IRVVKK
NT seq 5421 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagcaattgatcgccttgattacaataggcgtttgtgtgctatcgatgatagcc
gcctgtaatcgtagtgcagtttctctcagctataccaatgccaaaggtgaagtacaatcc
ctcggtaacctggtattccgctttgataaatcccttgttcctgattccttgttgaacaac
tgggattccactgagtatatttcttttgaacctaagattgccggccgttttcgttgggaa
catcccgatgaactggtgttttctcctgcacaaccgctgtcgcctgctaccagttataag
gcgaagctctccggcgatctgctcgaccatagcaaatatggcaagctcgacaaaggcgaa
gagatcaattttttcacaccgtacttacaactggataataccaacgtaacctggatgctg
cccgatcagcattccactaccgcgtacccgcaggttgatctgtattttaactacgctatc
agtcctgctaccattaaagataaaatgaacctggtggtagatggcaagccgttgaagtat
agtattattaccgaaggccccgacagccgcatttcgctccgccttgcgggggtgaaaatg
gaagataaagacctggaggctaaagtaacctttgaaaaaggactggtgcccgatggcggg
gtgaatggcaccaaagatgcgattgaaaacaaagtgttcattccatctccgtataatctc
actattaatgatgtacatgccgaacacgatgggttaaccggaaccgtgtttgttcgtacc
agtcagcaggtggtaatgtcaaatctcgcttcgcttatccggtttgaaccggcggtaaag
ttttcggttcaacaaaccgaagatggttttaccataagcagcgagaactttgatgctgat
aaaagttatgtattaaatataaacaagggtgtgagtggccgcattggtggtacattgcat
gagccgtatagtaataatgtggtgtttggtgagctggaaccttcgttgagttttgccaac
agcaaagctgtatacctgagcgcgctgggtaaccagaacattgaagtgcgccttactaat
gtgccaaaggtaaaagtgatcatttcaaagatctacgaaagcaacctgctgatggcgcag
cggtatggctatagccctaaagactcaagaggcgaaggcgaaggagaagatggcgagtac
tatggcggcgattatgaagataacagcgacctggcgttgggtgatgtgatctatgaacag
gagatcgatacgcgttcgttacccaaatatggcaacagccacctgtttacatttaatgta
gaagataagctgcccgattttaaaggtatttatcacatcaagttgcggtcggctaaggat
tattgggtaagcgacagccgtttcatttcaaaatcggacataggtttaatagcccgcgaa
ggaaaagataaattgtttgtatttgccaactctattaaaacggctcaaccggtaaacggc
atgaacgtagtggtgtatggcaataacaaccaggtgcttggtaccggcgccaccaataca
gacggcgtggctgaagttgctttatcgcgtaaggagtttgccgggtttaaacctgcgatg
atcattgccaaaacagccaatgatttcaactacctgccgttcaacagcacaagagtaaat
acttccaggttcgatgttggcggtaaacacagcaacactaccgggctggatgcgtttatc
tatgctgaacgcgatatttaccgtccgggtgaaaaggtgaacttttctgtgatcctgcgc
gaccgccagtggaaatcaccgggcgagctgccggtaaaaatgaagttcctgttaccaaac
ggtaaggagttaaagaacttccgtaaaacattgaatccccagggtgctacagacggcgat
gtggatatttccgaagcggctatcactggtagctatacgctggaagtatatacctcaaac
gacgtattgctgggcagcaagaacttcagcatcgaggaatttgtgcccgatcgtattaag
gtaactgccaaactggataaaccttacctggaaccggcacagagcgcgcacctggctatc
actgctgtaaacttttttggaccgccagctgcgaatcgtaattatgaagcagaggtccag
acaagcgttatcaacttcgatccaaaaaaatacgacacttataatttcagtatagaaaac
cagggtctgtcatttgacaaagtggtgaaagaaggcagcaccgatgacaatggcaatgcc
agtgtagagtatgaagcgcctgccttgtttgctaacaaagggttgttacagacaactttt
tatgcaaccgtttttgatgaaaccggccggccggtaagccgcagcaccactgccaatatt
tatacccagaaaatgttctttggtattggaagcgatgggtactggtattacccgctgaac
cagacggtgaatttcccgttgattgcgctggataaggatgagcatgtgctgaatggcgcc
cgcgcctcggtaaaagtgatcaaacatgaataccggaccgtgatctcaaaaagcggtagt
tatttcaagtatgaatcacagaaagatgataaagtagtggctgaacagaatattaccatc
agcggtgacaaaagcacctttccctttgtgccccgttcacccggtgattatgaactgcag
gttgccattcccggttcagaaagttatgtaagcaaaagcttctatagttatggcttctgg
ggtggcgaaaactcttcatttgaagtaaacaccgaagggaatatcgatattgaagctgat
aaatcttcttacgaagcaggcgagaacgccaaactattgtttaaaacaccgtttgatggt
cgtatgctggttaccctggaaaccgataaagtggtttcgtatcaatatgtaaatgttgac
aaaagatcggcatcggttgatctgaaaatgactgccgaccatttgccaaacgtatatgta
acggccacgttgataaaaccacatgatgttagtgaaatgccgttaacggtagcgcacggg
tataagagcctgaaagtagaagagaagagccgtaaaataaatgtagagatcgtagcgcaa
aagtcggttcgttcacgtacccaccagaaggtgactgtaaaagcagcacccaacagcttt
gttacattagctgctgttgataatggtgtattacaaataacagatttcaaaacacccgat
ccatacaaccatttctatgccgccaaagcactggaagtaaacggctatgatctgtatccg
ctgttgttccccgagttgaaagctacgctgagcagcacgggtggtgacggggaactggaa
atgagcaaacgcaccaaccccatgccagccaaacggttcaagatcgtttcatactggagc
ggttcaaccaaaaccggtggtagcggagaagcggagtttgaatttgatattccgcagttc
agtggtgaagtacggttgatggcggttgcttataaagatgaaagctttggcagtggcgaa
actgcgatgacggtggcagatcctttggtcttaagtaccgcattgccgaggttcctgagc
ccgggcgataccgtaacagtaccggttaccattaccaatacaacaaaaggttctacttca
gcaacagctaccttaaatgtaagcggtccgctgaatgtgctgggtgataaacaacaaacc
gtttcacttaacagcaacagcgaaggtcaggccatcttccagctggttgcttcgcctgcg
gtaagtaccggtaaagtaagagtggatgtacagggattgggtgagaagttcaccgatgaa
acggagatcagtgtgcgccctgcttctccattgcaggtagtaacaggtagcggatcgttc
actggtggcaatgcacaacacctcaatattccgctgaatgattttctgcccaatagtacc
gattaccaattagtagtaagccgcagtccggcactggagttgggtaaacaattgcggtac
ctggtttcttatccgtatggttgtactgaacaaacggtatcaaccgccttcccgcaattg
tacattggcgatctggccgatcagttgcacactgttgagggtggtaaatctattgccaac
tataatgtgcaggaagccattcggaagatcaaattacgccagttgtacaatggtgctgtt
accctgtgggatggcgaaggcacggaagactggtgggctaccatatatgcggcgcacttc
ttactggaagcgcaaaaggccgggtttgaagtagataagaatgtgctgaatggcattctc
aactacatgaacaataagttgaagaacaaggaaaccattttgtactactacaataaagac
cagaaaaagaaaattgcgcccaaagagatcgcatacagtttatatgtgctggcattggca
ggtaaacccaatgtgagtgcgatgaactattacaaggccaatcctatgttgctgagcctt
gattgtaaatacctgttgagtgtggcctacgcaatagccggtgataaagcgaagtttaag
gaactgttgccttcttccttcactggtgaagtatcggtggcgcaaaccggtggcagctat
tattcagatatccgcgatgaatcaattgcattgaatgccttactggatgtagacccatcc
aatacacagatccctgtgatggcgaaacatgtagctgataaaatgaaacaacgttactgg
tacagcacgcaggaatgtgcattcagcttcctgagcctgggtaaaatggcccgtgccgcc
agcaaggctacggtaagtgcggatgtaaaagtaaatggcaaaacagtgggcagtgtttca
aacagtccgctgaaattaaccgccaaacaattaggcggcaccaatatagatcttacttcc
aaaggtgaaggccgcctgtattactactggcaaagtgaaggcatcagcgtaagtggcgcc
tataaagaagaagacagctacattaaagttcgccgccgcttctttgaccgctatggccgg
gtgattgatggcaatacgttcacgcaaaacgacctggtggtggttcagatcaccctggag
aaatcgtacagtggtgatgtggataatatcgttatcagcgacattctgcctgccgggttt
gaaattgagaacccccgtaccaaggaaattccgggtatggagtggatcaaggatgcggcc
acgcctacggcgctggatgtgcgcgacgatcgtattaatttatttgataacctgggcagc
agccgtaaaacatattactatgccgtacgtgccgtatcgcctggcaattaccgcatggga
cctgtaagcgccgaggccatgtataatggtgaataccattcgtataatggaggtggtgtg
ataagggttgttaagaagtag

DBGET integrated database retrieval system