KEGG   Niastella koreensis: Niako_5065Help
Entry
Niako_5065        CDS       T01679                                 

Definition
(GenBank) GMP synthase (glutamine-hydrolyzing)
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
nko  Niastella koreensis
Pathway
nko00230  Purine metabolism
nko01100  Metabolic pathways
Module
nko_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Niako_5065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nko01002]
    Niako_5065
Enzymes [BR:nko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     Niako_5065
Peptidases [BR:nko01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   Niako_5065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMP_synt_C GATase NAD_synthase Peptidase_C26 tRNA_Me_trans QueC PAPS_reduct ThiI
Motif
Other DBs
NCBI-ProteinID: AEW01304
UniProt: G8T9W0
Position
6279845..6281377
Genome map
AA seq 510 aa AA seqDB search
MTEKILILDFGSQYTQLIARAVREANVYCEIIPYHKKVEFDPSLKGIILSGSPFSVNDVN
APEVDVQALNQQLPVLGVCYGAQLTAKQFGGQVAKSNKREYGRALMHKQTDDVLLKDVME
KSQVWMSHSDSVLQLPAGFNVLATTDGIPFAAFKKNGETNPLYCVQFHPEVYHSTEGKKM
IKNFLVNICGCKQDWTPAHFITDTVNDLKKQIGDRKVIMALSGGVDSTVAATLIHRAIGK
NLYGIFVDNGVLRKNEFEQVLETYNTIGLNVKGVNAKQLFYDQLAGKTDPEAKRKTIGRL
FIEVFQQEAKAFEGVELLGQGTIYPDVIESVSVHGPSVTIKSHHNVGGLPDIMHLELVEP
LRFLFKDEVRRVGAELGIPSDLLNRHPFPGPGLAIRILGEITPDKVELLQEADHRYIQGL
KEHKLYDQVWQAGAILLPVKSVGVMGDERTYEFTVALRAVTSVDGMTADWAHLPYEFLAH
ISTDIINNVRGINRVVYDISSKPPATIEWE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaagattctaattctcgatttcggcagtcagtatactcaattgattgccagg
gccgtccgggaggccaacgtgtattgcgaaataattccctatcacaaaaaagttgaattt
gatccttcactgaaaggtataatcctgtcgggttcgcctttttctgtgaacgacgtcaat
gccccggaagtagatgtacaagcacttaatcagcaactgcccgttttaggagtttgctat
ggcgcccagttaacggccaaacaatttggcggacaggtagccaaaagtaacaaacgcgaa
tacggtcgtgccctcatgcacaaacaaaccgacgacgtgttgctgaaagatgtaatggag
aaatcgcaggtttggatgagccacagcgactccgttctgcaattacctgccgggttcaat
gtactggccactaccgacggtatccccttcgccgcctttaaaaagaacggcgaaaccaat
cccctgtactgcgtacaatttcaccccgaagtgtaccactctacagaagggaaaaaaatg
attaagaacttcctcgtaaatatctgtggctgcaaacaggactggacgcccgctcacttt
atcaccgatacggttaacgacctgaaaaaacagatcggcgatcgtaaagtgataatggcc
ctgagtggaggtgttgactctactgttgccgcaacattgatccatagagccattggtaag
aacctgtacggcatttttgtggacaacggcgtgttgcgtaaaaatgaatttgaacaggta
ctggaaacctacaacaccattggcctgaacgtaaaaggtgtaaatgccaaacagttgttt
tacgatcagctggcaggcaaaaccgatcccgaagccaaacgtaaaaccatcggccgcctg
tttattgaagtatttcagcaggaagcaaaagcttttgaaggtgttgagctgttaggccag
ggtactatttaccccgatgtgatcgagagcgtttctgtgcatggtccttcagtaactatc
aaatcgcaccacaatgtgggcggtttacccgatattatgcacctggaactggtagaaccc
ctccggttcctgtttaaagatgaagtacgccgcgtgggggcagaactgggaattcccagc
gatttgttaaatcgccatcccttccccggccccggtttggccatccgcattctgggtgaa
attacgcctgacaaagtggaattattacaggaagccgatcatcgctatatccagggattg
aaagaacataaattatacgaccaggtatggcaggcaggcgccatcttactaccggttaag
agtgtgggagttatgggtgatgaaagaacgtacgaattcaccgtagctttacgtgcggta
acttcggtagatggcatgaccgccgactgggctcacctcccttatgaatttttggcacat
atttcgactgatatcatcaacaatgtaagaggtatcaaccgggtggtatacgacatcagc
agtaaaccacctgcaacgatagaatgggagtaa

DBGET integrated database retrieval system