KEGG   Niastella koreensis: Niako_5067Help
Entry
Niako_5067        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
  KO
K07577  putative mRNA 3-end processing factor
Organism
nko  Niastella koreensis
Brite
KEGG Orthology (KO) [BR:nko00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    Niako_5067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 Lactamase_B_3 RMMBL
Motif
Other DBs
NCBI-ProteinID: AEW01306
UniProt: G8T9W2
Position
6282912..6283931
Genome map
AA seq 339 aa AA seqDB search
MPLISFTDKGLYCEQGNFYIDPWQPVDKAVITHAHSDHARPGSQSYLCHRDSLPLLKLRL
GPYNYQTVEWNERIYMNEVMVSLHPAGHIIGSSQVRVEHKGEVWVVSGDYKTEPDGISGV
FEPIPCHTFISESTFGLPIYNWKPQHEIYHEIQNWVRSNEVAGKTSVLIGYSLGKAQRIL
QALEEVTGNIYVHGAIWNVQETLLQTGHKFPAVQRITPDTPKDAFKGSVVIAPPSADGSA
WMRRFTNSSTGICSGWMQVRGNQRRRNADAGFALSDHADWQGLLQAVKATGAQKVYITHG
FQSVFSRYLNEIGIDASEVKTEFGTEEEEGTSENATTEN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaatctcctttacagacaaaggcttgtattgcgaacagggcaacttctacatt
gacccctggcaaccggttgataaagccgtgatcacccatgcccacagcgatcacgcccgg
cctggcagccagtcttacttatgccaccgggatagtttgcctctgctaaaattgcggttg
ggtccatacaattatcaaacagttgaatggaacgaaaggatctatatgaatgaagtgatg
gtatcgcttcatcctgcgggtcatatcattggttcttcccaggttcgggttgagcacaaa
ggcgaagtgtgggtggtaagcggcgattataaaacggaaccagatggcatcagcggggta
tttgaacccatcccctgtcatacgtttatttcggaatcaacattcgggttgcccatctac
aactggaaaccgcaacacgaaatttatcacgagattcaaaactgggtgcgcagcaatgag
gtagcaggtaaaacttctgtgctcattgggtacagcctgggaaaagcacagcggatatta
caggcgctggaagaagtgaccggtaatatttatgtgcatggcgccatctggaatgtacag
gaaaccctgctgcagacaggtcataaatttcctgccgtacaacgcattactcccgataca
ccaaaggatgcattcaagggcagcgtggtgatagcgccgccttcggcagatggcagtgca
tggatgcgtcgttttactaatagcagtaccggcatttgcagcggatggatgcaggtacgc
ggcaaccagcgacgcagaaatgccgatgcaggttttgccctcagcgatcatgccgactgg
cagggactgttacaggcagttaaagccaccggcgcccaaaaagtatacatcacccatggg
tttcaatctgtgtttagccgctacctgaatgaaattggtatcgatgcatctgaagtgaaa
acggaatttggaacggaggaggaagaaggcacatctgaaaatgcaacaactgaaaattag

DBGET integrated database retrieval system