KEGG   Niastella koreensis: Niako_5069Help
Entry
Niako_5069        CDS       T01679                                 

Definition
(GenBank) cytochrome c class I
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AEW01308
UniProt: G8T9W4
Position
6285721..6287088
Genome map
AA seq 455 aa AA seqDB search
MVLILIVISGVAFTGVFISEYEPVPIPPSTQRMGGDVQKGYEYLTTGEYVKGGIPFRTWL
MGMGKSKTNYLQRTGNNAEVSHEYNTVTAANGEVLVAPNCLQCHAQVFDGKLVIGLGNTF
MDFTHNEKTNVKNLKMVESMLKLTSASRYKAAKPFLDVAEIVTPFLITNIRGVNTADRLA
AVLASHRDPVTFKWNPEAQLDIPEMVIPSDVPPWWLLKKKNAMFYNGFGRGDFGRFLMAS
NLLTVNDTAESAEVDSHMPDLLAYIFSLEPPKYPGTIDKALAGDGEKIFNKKCGGCHGSY
GATEKYPNLLIPEPVIQTDSLLYKYNYSSPQFVEWFNKSWFTTGDHPARLEPFMGYIAPP
LDGIWVTAPYLHNGSVPTLEALLNSDLRPKYWSRDFDNPEYDYEKLGWKFTKETKALDKF
TYNTDLPGYGNYGHTFGDRLTEKERKVVLEYLKTL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttattctcatcgtgatcagtggtgtagcctttaccggtgtgtttatcagcgaa
tatgaacccgttcctattccgccaagtacacaacgtatggggggcgatgtgcagaaagga
tatgagtatcttacaaccggcgaatatgtaaaaggcgggatccctttcaggacctggttg
atgggcatgggcaaaagcaaaaccaattacctgcaacgcaccggtaataatgccgaggtc
tcgcacgaatacaatacagttacagcagccaatggcgaagtactggtggcgcccaactgt
ttgcaatgccatgcacaggtgttcgatggtaaactggtaataggcctgggtaataccttt
atggatttcacccataatgaaaagacgaatgtaaagaacctgaaaatggtggagagcatg
ttgaaactcacctccgccagcaggtacaaagcagccaaaccatttctggatgtagcagaa
atcgtcacacctttcctcataactaatatcaggggcgtgaatactgccgatcggctggca
gccgtattggcatctcaccgtgaccctgtaacatttaaatggaaccctgaagcacagttg
gatattcccgaaatggttattccatctgatgtaccaccatggtggttgctgaagaaaaag
aatgcgatgttttataatggatttggccgtggcgattttggccggttcctgatggcctct
aacctgcttaccgtaaatgacacggcagagtctgcagaagtagattcacatatgcccgat
ctgctggcttatatcttttcattggaaccacctaaatatcccggcactattgataaagca
ctggccggtgacggcgaaaagatcttcaacaaaaaatgtggcggctgtcatggctcctat
ggcgctaccgaaaaatatcccaacctgttgatccccgaaccggttattcaaacagactca
ctgttgtacaaatacaattattccagtccgcagtttgttgaatggtttaataaaagctgg
ttcaccaccggtgatcatccggcacgactggaaccatttatggggtacattgcgcccccg
ctcgatggcatctgggtcacagcgccttatctgcacaacggatctgtgccaacgttagaa
gcgttgctcaacagcgatcttcgtcctaaatactggagccgcgatttcgataaccccgaa
tacgattatgaaaagctaggctggaaattcaccaaagaaaccaaagccctcgataaattc
acctacaataccgatctgcccggttatggtaactatggccatacctttggcgacaggctt
acggagaaagagcggaaggtggttttggagtatttgaaaaccttataa

DBGET integrated database retrieval system