KEGG   Niastella koreensis: Niako_5075Help
Entry
Niako_5075        CDS       T01679                                 

Definition
(GenBank) aminoglycoside phosphotransferase
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH EcKinase Choline_kinase DUF3234
Motif
Other DBs
NCBI-ProteinID: AEW01314
UniProt: G8T9X0
Position
complement(6296132..6297121)
Genome map
AA seq 329 aa AA seqDB search
MQPFPVVCSTLSATHLAAYLQQQYGFGAGTTCRLLRAAINHAYLVTDGEQQYVFRVYSYN
WRTDLEITEELRLLRVLKENDIPVSFALPDAQGNFIQHIPAPEGMRMAVLFSYAKGEKVL
NYSPELHYKLGVIMARMHTITKGMYLQRPKYTPATLLKDSFELVKQFIAADTEEMKWMKK
VQAYLMEQYDNTFPELLRFGVVHMDIWFDNLHIYNNEDITFFDFDFCGNGWLVQDIAYYM
LQLFNTEKDTEQHALKLKHFLTGYESVTPIHDHEKELIPAASVAMYFFYLGVQCQRFENW
TNTFLNETYLKRYINMFVKKLCEHYQLPV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccttttccagttgtgtgttccacgctgtcggcaacacatttggctgcctatctg
caacaacagtatgggtttggcgcaggcactacctgccgtttattacgcgcggctatcaat
catgcttacctggtaacagatggggagcagcagtatgttttcagggtttacagttataac
tggcgcactgatttagaaataacagaagagctcaggctgttacgggtgttgaaagaaaac
gacattcctgtttcatttgcactacccgatgcacagggaaattttattcaacatatacct
gcaccagaaggcatgcgcatggccgtgttattctcttatgcaaaaggagagaaggtgttg
aattattcaccggagcttcattataagctgggtgttattatggcccgtatgcatacaata
acaaaaggaatgtatttacaacgcccgaagtacacccctgccacgttattgaaggattca
tttgagttggtaaaacaattcatcgctgcagatacggaagaaatgaagtggatgaagaaa
gtgcaggcgtatttgatggaacaatatgataatacatttcctgagttgttaaggtttggg
gttgtgcacatggatatctggttcgataacctgcatatttataacaacgaagacatcacc
ttctttgattttgatttttgtggcaatggctggctggtacaggatattgcctattatatg
ttacagctcttcaataccgaaaaagacaccgaacaacatgccttaaagctgaaacatttt
ttaaccggttacgagtcggtcactcctatacacgaccacgaaaaggaactgatccccgcc
gccagtgtggctatgtatttcttttacctgggcgtgcaatgccagcgttttgagaactgg
accaatacctttttgaatgaaacctacctgaagcggtacatcaacatgttcgtaaagaaa
ttatgcgagcattaccaattgccggtatag

DBGET integrated database retrieval system