KEGG   Niastella koreensis: Niako_5080Help
Entry
Niako_5080        CDS       T01679                                 

Definition
(GenBank) 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
nko  Niastella koreensis
Pathway
nko00790  Folate biosynthesis
nko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Niako_5080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nko03016]
    Niako_5080
Enzymes [BR:nko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     Niako_5080
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     Niako_5080
Transfer RNA biogenesis [BR:nko03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Niako_5080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTPS
Motif
Other DBs
NCBI-ProteinID: AEW01319
UniProt: G8T9X5
Position
6300259..6300672
Genome map
AA seq 137 aa AA seqDB search
MSKKVAVYRKEHFNAAHRLYNPAWDMAKNDAVFGKCNNPNFHGHNYEVVVKVTGVPDPET
GYVMDMKILSDLIRDHVLEQFDHKNLNLDTVYFKTLNPTAENICVVIYDLLRAQIAPQFD
LQVRLYETERNFVEYPA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaagtggcagtttaccgaaaggaacattttaatgcggcccaccgcttatac
aaccctgcgtgggatatggcgaagaatgatgcggtgtttggtaaatgtaataatcccaat
tttcatggccacaattatgaagtagtggtaaaagttaccggggtacctgatcccgaaacc
ggttatgtgatggacatgaaaatattaagcgaccttatcagggaccatgtgcttgaacaa
tttgaccataagaaccttaacctcgatacagtgtattttaaaacactgaatccaacggct
gaaaatatttgtgtggtgatctatgatttgttgcgtgcgcaaatagccccccagttcgat
ctgcaggtacgtttatatgaaacggaaagaaattttgtagagtatccggcataa

DBGET integrated database retrieval system