KEGG   Niastella koreensis: Niako_5083Help
Entry
Niako_5083        CDS       T01679                                 

Definition
(GenBank) peptidase S41
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S41 Pept_S41_N
Motif
Other DBs
NCBI-ProteinID: AEW01322
UniProt: G8T9X8
Position
complement(6302571..6303881)
Genome map
AA seq 436 aa AA seqDB search
MKTIVAGAIIAGITLASCRKNHDVISSEVKVDTTVNYARDIYLWHNNIPASLDPHLFTDP
NAVMEGIRAYSSEPGFNLPVDRWSFAMLQSDWNKLSTGIGGDFGMNIFFYADDDLRVSYV
ERESPSGKAGIKRSWHIKQINGVSNFTVANSNDIIRAVYQSPAGTFVFGRPNNTDTTITL
KASSYREHPLLFDSVYNSNGNKTGYFVFNSFLGDTIEISNEFERIFNKFGSEHVQDVVVD
LRYNGGGYVSVQNLLANYLVPAAGNNQIMLTEEFNDKYIAYNTTENFAKKGSLNLSRLFF
IVSQNTASASELLINSLKPYLDVELVGPTHTHGKPVGFYPIPVFDWYIFPVSFRTVNKLG
EGNYFNGLALDHQVVDGLDKDWGDGSEECLNAVLHFISSGSYARMAVTPQQRLGLTEEVL
FSNAALGKTKFKGMLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatcgtagcaggcgctatcatagccgggattacactggcgagctgcagaaaa
aatcatgacgtaattagcagtgaggtcaaagttgataccactgttaactacgcacgtgat
atttatctgtggcataacaacattcctgcttcactcgatccccacctgttcacggatccc
aatgcagtgatggaaggcatcagggcttacagctcagagccggggttcaatctgccggtt
gacaggtggagtttcgccatgctgcaatctgactggaacaagctgagcaccggtattggc
ggtgactttgggatgaacatttttttctatgccgatgacgatctgcgcgtatcgtatgta
gaacgggaatcaccctcgggcaaagctggcatcaaacgcagctggcacatcaaacaaatc
aacggcgtttccaattttacggttgccaattccaatgatatcataagggctgtataccaa
agccctgccggcacatttgtttttggccgccccaataataccgataccaccatcacttta
aaagcttcttcttaccgcgaacatccgctgttgttcgattctgtttataacagcaatggt
aataaaaccggctattttgtattcaattctttcctgggcgacaccattgagatcagtaat
gaatttgaacgcatctttaataagttcggcagtgagcatgtgcaggatgttgtagttgac
ctgcgttataacggcggtggttatgtgtctgtacagaacctgctggccaattacctggtg
cctgcagctggtaacaaccagataatgcttaccgaagagtttaacgacaaatacattgcg
tacaataccacggagaattttgcaaaaaagggcagcctcaatctcagccggcttttcttt
atagtaagccagaacacggcatcggccagtgagctgttgataaacagtttaaagccgtat
ctggatgtagaactggttggccccacccatacccatggcaaaccggttggtttttaccct
ataccggtatttgactggtatattttcccggtgtcgttccgtacagtaaataaactgggc
gagggaaattatttcaacgggttagcccttgaccaccaggtggttgacggcctcgataag
gactggggcgatggcagcgaagagtgtttgaacgcggtgttgcattttatcagcagcggt
tcttacgcccgcatggctgttaccccgcaacaacgcctcggtttaaccgaagaagtgttg
tttagtaatgcggcgctgggaaaaactaagtttaaagggatgctccgataa

DBGET integrated database retrieval system