KEGG   Niastella koreensis: Niako_5091Help
Entry
Niako_5091        CDS       T01679                                 

Definition
(GenBank) PKD domain containing protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PKD CHU_C
Motif
Other DBs
NCBI-ProteinID: AEW01330
UniProt: G8T9Y6
Position
complement(6317569..6320196)
Genome map
AA seq 875 aa AA seqDB search
MRRSLAIALLLFFGTIQSLFAEHIKGGEMFYEYLGPGSDANTSQYRVTLKLYIDCNATSS
GQLDTEIGLTIFDKSTNRQYSTAKAPYVGDVFLKFDPASNPCISNPPTDVCYRVRSFSTV
ITVPINSDGYTIAYQRCCRINNIVNVQPPSNAVGATYMCEIPGTSVLPDAYKNSSPRFLP
NDATAICRGSNFTLSFAATEPDGTDSVAYTFCNGFIGASSSQPSPAVASTPPYSSLNYQS
PFNGSAPLGNQVTINSKTGVISGIAPSTIGQYVITVCAYEYRRGVLINIHRKDVHVKVSD
CIPLEALLNPNYSFCDDFLVTFKNEQVNPAGSVYTWDFGDGTPPATTTDLEGKVQHQYAD
TGTYTVKLHVVLAGQCEDQTVTLAKVYPGFFPAFSVQGSCLLLPLQFIDQTTSKYGHAAK
WSWNFGDETTNTDVSTLQNPTWKYSTTGIKTVTLTVESDKGCVATITNPADVRDKPAIPL
PFTDTLICSIDTLQLIAGGNGIFSWAPNYNIMNANTATPLVWPKLTTTYTVTLNENGCVN
TADVRVRVVDFVTLDAGADSTICLTDTVQLNPQTDGLKFEWTSDIPSYFDNPNVKQPWVR
PTATTKYHVVAHIGKCSAADDVTLYTVPYPIARAGADTLICYDDTASIHASMVGYRFIWS
PISTLSNPNSLNTLAWPKRTTSYVLSVYDTLGCPKPGRDTIVVKVKNEIIAFAGRDTSVV
VGQPLQLNGQGADFYEWQPPLHLNRNDVYNPVAVLDDNFSYQLKAYTAEGCYDLDTINIK
VFKTAPDIFVPNAFRPGGSRNNVLRPIPVGIATLDYFCVFNRWGQMVYRGYSAESGWDGS
LSGRPQDPGTYVWMAKGTDYTGKVVMRKGTAILLR
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatccctggcgatagctttgttattgttttttggaacaatccagtccctcttt
gctgagcacatcaaaggtggggagatgttttatgagtacctgggaccgggaagtgatgcc
aatacttctcaataccgtgttactttaaagttatatatcgactgtaatgccaccagcagt
ggacagcttgacaccgagattgggttgaccatattcgataaatctactaacaggcagtat
tctactgcaaaggccccctacgttggcgatgtgtttctgaagttcgatcctgcttccaat
ccctgtatcagcaatccacctacagatgtttgttaccgggtgcgctcgttttccacagtt
attacggtgccaattaatagcgatggatatacaattgcctatcagcgttgttgccgtatc
aataatattgtaaatgtgcagccccccagtaatgctgtgggcgctacctatatgtgcgaa
attcccggcaccagtgttttgccggatgcctataaaaattcaagcccccggtttttaccc
aatgatgctaccgccatttgccgcggcagtaattttactttgagttttgcggctactgag
cctgatggtaccgattccgttgcctataccttttgcaacggttttattggcgcctcttcg
agccagcccagccccgctgtagcttccacaccgccctattcatcattgaattaccagtca
ccttttaatgggagtgcgcctcttggcaaccaggtaactattaattccaaaacaggtgtt
atcagtggaattgcgccttccaccatcggacagtatgtgataacggtttgtgcatatgaa
taccgcaggggtgtgttgatcaatatccatcgcaaagatgtgcatgtgaaggtgtcggat
tgtattccgctggaagccctgttgaaccccaattattctttttgcgacgacttcctggta
acttttaaaaatgaacaggtaaaccccgccggctcggtatacacctgggattttggcgat
ggtacacctcctgcaactactaccgatctggaaggcaaggtacagcaccaatatgccgat
acaggtacttataccgttaaattgcacgtagtgctggccgggcagtgtgaagaccagaca
gtaacgctggccaaagtgtatcccggtttcttccccgctttttcggtacagggcagttgc
ctgttattgcctttgcagttcattgatcaaactacttcaaaatatgggcatgcagctaaa
tggagttggaattttggtgacgaaaccaccaacaccgatgtatctactctgcaaaaccca
acctggaagtacagcactaccgggattaaaacagtaacgcttacggtagagagtgacaaa
ggttgtgtggccaccatcaccaacccggccgatgtgcgggataaaccagccattcctctt
ccgtttaccgatacccttatatgcagcatcgataccctgcagctgatcgccggtggaaat
gggatcttttcctgggcgcccaattataatatcatgaatgcaaatacagccacgccgctg
gtgtggcccaagcttaccactacctataccgttaccttaaacgaaaatggttgtgtgaat
acagccgatgtacgggtgcgggtggttgattttgtaaccctcgatgccggagcagacagt
acgatctgccttacggatacagttcagttgaatccgcaaaccgatggtttgaagtttgaa
tggacttcggatattcccagctattttgataatcccaatgtaaaacagccctgggtgcgg
ccaacagcaaccaccaaatatcatgtggtggcgcatattgggaagtgttctgcggcagat
gatgtaactctgtataccgtcccataccccatagccagggcaggagccgatacgctgatc
tgttatgacgatacggccagcatacatgccagtatggtgggctatcgctttatctggagc
cccattagtaccttaagcaatccaaacagtttgaacacacttgcctggcccaagagaaca
acttcgtatgtgcttagtgtgtatgatacgttgggctgtcccaaacccggcagagatacc
attgtagtgaaggtgaaaaatgagatcattgcttttgcgggcagagatacctccgttgtg
gtgggccagccattgcaattaaacgggcagggggctgatttttatgaatggcaaccaccg
ttgcaccttaaccggaacgatgtttataaccctgttgctgtgctggatgataatttcagc
taccagttaaaagcttataccgccgaagggtgttacgatctcgataccatcaatatcaaa
gtatttaaaacggcgcctgatatttttgtgcccaatgcattccggccgggtggcagccgc
aacaatgtattacggccaataccggttggtatagccaccctcgattatttctgcgttttc
aaccgctggggccagatggtatacagaggttattcagccgagtctggttgggacggctcg
ctcagcggcagaccacaagacccgggtacctatgtttggatggccaaaggaactgactat
accggtaaagttgttatgagaaaaggaacagcaatattgttaagataa

DBGET integrated database retrieval system