KEGG   Niastella koreensis: Niako_5092Help
Entry
Niako_5092        CDS       T01679                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Abhydrolase_5 PGAP1 Esterase BAAT_C DUF676 DUF915 Peptidase_S9 DUF900 Thioesterase LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: AEW01331
UniProt: G8T9Y7
Position
complement(6320223..6321032)
Genome map
AA seq 269 aa AA seqDB search
MATENNILLNDKPVFYRIEGQGQPVVLVHGFAEDGTVWEHQVEYLKNKFQLIIPDLPGSG
RSPLNDADWSMEYFADCICYILDQENIKTASMIGHSMGGYITLAFAEKYPDRLQSFGLFH
STAYADSEEKKTARRRGIEFIQQYGATKFLEQSYPNLFSDLSKKQQPELVHKLLARYTNF
VGLSLVNYYQAMIVRPDRTHVLKNFSRPVLFIMGKLDNTIPYEQILQQCYMPGLSYIHTL
EQSGHMGMWEEPELSNVFVEEFLMHGQFV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaaaacaatattcttctaaatgataaaccggtattttatcggatagaaggg
caggggcagccggttgtgttggtacatggttttgctgaagatggtactgtgtgggagcac
caggtagaatatttaaaaaacaaatttcaactaatcatccccgatcttcctggcagtggc
cgttcgcccctgaatgatgctgactggtcaatggaatattttgccgactgcatttgttac
atccttgatcaggaaaatataaaaactgccagcatgatcggccatagtatgggtggatat
attacgctggcctttgcagaaaaataccctgacaggctgcaatcgtttgggttgtttcat
tctacggcatatgccgatagtgaagaaaaaaagactgcccgccgccggggcatcgaattc
attcagcaatatggtgccactaaatttttagagcagtcttatcccaatcttttctccgat
ttatcgaaaaaacagcagcccgaactggtgcataaattattagcccgctacaccaacttt
gttggcctgtcgctcgtaaattactaccaggctatgatcgtgcgtcctgaccgaacgcat
gttctcaaaaacttttcccgccctgttttgttcatcatgggaaaattagataatacgatc
ccatatgaacagatattgcaacaatgttatatgcctggattgtcatatattcatacactt
gaacaatccggccatatgggaatgtgggaagaacctgaactaagtaatgttttcgttgaa
gagtttttgatgcatggccaatttgtataa

DBGET integrated database retrieval system