KEGG   Niastella koreensis: Niako_5099Help
Entry
Niako_5099        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Haem_bd zinc_ribbon_6 DUF2024
Motif
Other DBs
NCBI-ProteinID: AEW01338
UniProt: G8T9Z4
Position
complement(6329284..6329748)
Genome map
AA seq 154 aa AA seqDB search
MKKKIVPALLVLLIVIQFIRPARNLSAAVSPNDISRHYTVPDTVAHILQRACNDCHSNNT
RYPWYTNIQPVGWWMQHHVNEGKDELNFSEFGAYTSKRQNHKMEEVGEQVEKGEMPLDSY
LWIHKDAKLTAPEKEVLISWAKDLRNKIAEKGPL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaatagtgcccgctctgcttgtattgctgatcgttatccagtttattcgt
cctgcccgtaacctgtcggcagctgtttcccccaacgacattagccgccattatacggtg
cccgatacggtggcccatattttacaacgcgcctgtaacgactgtcatagtaacaatacc
cgttatccctggtatacaaatattcaaccggtaggctggtggatgcagcatcatgtgaac
gaaggaaaagacgaattgaatttttctgaattcggcgcctatacctcaaaacggcagaac
cataaaatggaagaagtaggcgaacaggtcgagaagggagaaatgccgctggacagctac
ctgtggatccataaagatgccaaactgactgctcccgaaaaagaagtcctgatttcctgg
gctaaagacctgcgcaataagattgctgaaaaaggaccgctctaa

DBGET integrated database retrieval system