KEGG   Niastella koreensis: Niako_5100Help
Entry
Niako_5100        CDS       T01679                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE HTH_23 HTH_28
Motif
Other DBs
NCBI-ProteinID: AEW01339
UniProt: G8TAZ2
Position
complement(6329836..6330495)
Genome map
AA seq 219 aa AA seqDB search
MSTELVIKVALADDHKIFRDGIKMALKGKEYLKILWEAEDGKDLMHKMQIKKPDVLLMDI
RMPEIDGVNAIGILRKEYSDVKILVLTMYDEQEMITKMMEMGANAYLTKTSDPDEIYQAI
LTCMNDDFYFNDLVNKAVLSKLQTKKQVRQFYPNPIKFSEKEIKILKLLAADKTTEEISK
EVFLSPRTIETIRQNMKSKVGAKTIAGLIMYGMRNKLID
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaactggttattaaagtagcacttgccgacgatcacaagatatttcgcgac
ggcattaaaatggctcttaaaggaaaagagtacctgaagattctttgggaagccgaagat
ggtaaagatctgatgcacaaaatgcagatcaaaaaaccagatgttttactgatggatatt
cgtatgcccgaaatagatggggtgaatgcgattgggatactccgtaaggaatacagcgat
gtaaagatcctggttcttaccatgtacgacgaacaggaaatgatcaccaagatgatggaa
atgggcgccaacgcttacctcaccaaaacctctgaccctgacgagatctatcaggccata
ctcacctgcatgaatgatgacttttactttaatgatctggtaaataaagcggtactgtcg
aaattgcaaaccaaaaaacaggtacggcagttttaccccaaccccataaaattttccgaa
aaagaaatcaagatcctgaagctgctggcggccgataaaaccaccgaggaaatttcaaaa
gaagtattcctgagcccccgcaccattgaaaccattcgccagaacatgaaatcgaaggta
ggcgctaaaaccattgccggcctgatcatgtacggtatgcgcaacaaactcatagattaa

DBGET integrated database retrieval system