KEGG   Niastella koreensis: Niako_5102Help
Entry
Niako_5102        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YibE_F Glycos_transf_4
Motif
Other DBs
NCBI-ProteinID: AEW01341
UniProt: G8TAZ4
Position
6331962..6332519
Genome map
AA seq 185 aa AA seqDB search
MYSFLNDIILLNLSAKLFLSTYTLVEFFLFSYFIWLIIEGRFFKKVIATVSTLFIIFICY
YFFTTKWNFFDSVPVACESILIFTFSLYYLFEQINKPRVLFIYNTSMFWVILGFLVYLAG
SFFIYTFVDEIDSRDIGKFWFITFIFNTIKNLFFSIAFSLREAKDKNSSSLSSYDNFFKN
PYNPL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgtactcattcctgaatgatataatactcttaaacctgtcggccaagctcttcctgagc
acatacaccctggttgagtttttccttttcagttatttcatctggctcattatagaaggc
cgcttcttcaaaaaagtgatagctactgtttcaacattgtttattatatttatctgttat
tacttttttaccacaaaatggaacttttttgattcagtgccagtagcttgcgaatcaatt
ctgatctttacattttccctgtattatttattcgagcaaataaacaaacccagggtactt
tttatatataatacttccatgttctgggttatacttggctttttggtttatttggcaggg
tctttcttcatctatacgttcgtagatgagatagatagcagggacatcgggaaattctgg
ttcatcacattcatattcaataccataaaaaatctattctttagcattgctttttcgctg
agagaagcaaaggacaaaaacagcagtagcctgtcctcatacgataatttttttaaaaac
ccctataacccattataa

DBGET integrated database retrieval system