KEGG   Niastella koreensis: Niako_5104Help
Entry
Niako_5104        CDS       T01679                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4 HTH_23 Sigma70_r4_2 HTH_11 DHQS Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: AEW01343
UniProt: G8TAZ6
Position
6333532..6334188
Genome map
AA seq 218 aa AA seqDB search
MGPIKVAIADDHKIFRKGVILSLRPYTNIKFVLEAENGQELLDNLPTAPEQPDVILMDLR
MPLKDGIETTKVIARQYPNIHVIALTMYEDERFVSHMMEIGANGYLLKSADPSEIKKAIM
EVMSKGYYLNNFVNRILLKKSHARVKVVPSLNSEITLSDRERDVIKYICMEFTAHEIAQK
LEVSPRTVEAIKDRLMERFGAKNTAGLVFFAVKNNLID
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgggacctattaaagtggctatagctgatgaccacaaaatattccgtaaaggagtaata
ttgtcgttaaggccttatacaaacataaaattcgtacttgaggcagagaacggccaggaa
ctgttggataacctgccaacggcccctgagcaacctgatgtgatattaatggacctgcgt
atgcccctgaaagatggcatcgaaactacgaaagtaattgcccgccaatatcctaacatc
cacgtaattgcgctaacgatgtatgaagatgaacggtttgtgagccatatgatggaaata
ggcgctaacggctacctgctcaaaagcgccgacccttccgagatcaagaaggcaataatg
gaggtaatgagcaaagggtattacctgaataactttgtaaacaggatacttttaaaaaaa
tcacacgcccgggttaaggtggtgcccagcctgaacagcgaaatcaccctcagcgaccgc
gaacgggatgtgataaaatatatttgcatggagtttaccgcccatgaaattgcacaaaaa
ttagaggtaagtccgcgtactgtagaagctatcaaagacaggttgatggaacgctttgga
gctaaaaacacggctggcctggtattttttgcagttaagaataacctgattgattaa

DBGET integrated database retrieval system