KEGG   Niastella koreensis: Niako_5109Help
Entry
Niako_5109        CDS       T01679                                 

Definition
(GenBank) hypothetical protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4835 UPAR_LY6_2
Motif
Other DBs
NCBI-ProteinID: AEW01348
UniProt: G8TB01
Position
complement(6337157..6338080)
Genome map
AA seq 307 aa AA seqDB search
MCRKIVWIFFMMVMAPVCLLAQELKARITINTQQLSTPADKKAFQTCQAALNNFLNNRKW
TKDTWQPNEKIVCNFLFIITEAQGGNVYKAKLTVQAARPIYNSNYDCPLINFMDENVIFK
YVEYQSIEFNENRVSGSDPIVGNLTAILAYYAYVILGLDYDSFALRGGDPYFQKAMNIVN
NAPEGRDISGWKAFDGLRNRYWLTENLTNNRYNLMHDAFYSYYRLGMDYMYENETDGRGA
ILNSLSLVNTMNNDIPNTMIVQFFFQGKSKELINIFKKGTPEDKQKAREILQKIDISNSN
LYKQELK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagaaagatcgtatggatattttttatgatggttatggcgccggtttgtttgctg
gcccaggagcttaaagcccgtattaccattaatacccagcagcttagtacgcctgctgat
aaaaaggccttccagacgtgccaggcggcgctcaataattttttgaacaaccgcaagtgg
acaaaggatacctggcagcccaatgaaaagatagtatgcaactttttattcattatcacc
gaagcgcaaggcggcaacgtatacaaagccaaacttacggtgcaggccgcccgcccgata
tacaattccaactacgattgcccgctcatcaattttatggatgagaatgtgatctttaaa
tatgtagagtaccagtcaattgagttcaatgaaaaccgggtgtctggttcagaccccatt
gttgggaacctcacagccatactggcttattatgcttacgttattctgggactcgattac
gactcttttgcgttacgaggcggcgatccatactttcagaaagccatgaatattgtgaac
aatgctcccgaggggcgtgatatttcgggctggaaggcatttgatggtttgcgtaaccgg
tactggttaacagagaaccttacgaataaccggtacaacctgatgcacgacgctttttac
agctattaccgcctgggaatggattatatgtatgagaatgaaacagacggccgcggcgcc
atcttaaattccctgagcctggtaaataccatgaacaacgacattcccaacacgatgatc
gtgcagttcttctttcagggtaagtcgaaggaattgattaatatttttaaaaagggcact
cctgaagacaagcaaaaagcaagggaaattttacaaaagatagatatctccaactccaat
ttgtataaacaggaattaaaatga

DBGET integrated database retrieval system