KEGG   Niastella koreensis: Niako_5112Help
Entry
Niako_5112        CDS       T01679                                 

Definition
(GenBank) outer membrane assembly lipoprotein YfiO
  KO
K05807  outer membrane protein assembly factor BamD
Organism
nko  Niastella koreensis
Brite
Transporters [BR:nko02000]
 Other Transporters
  Pores ion channels [TC:1]
   Niako_5112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YfiO TPR_6 TPR_16 TPR_2
Motif
Other DBs
NCBI-ProteinID: AEW01351
UniProt: G8TB04
Position
complement(6339745..6340560)
Genome map
AA seq 271 aa AA seqDB search
MRSALIIAIIALSVASCSKFSRVQKSTDYDYKLRMAEKYYVAKKYNYASQLYEELFPIMK
GQPQFEDLFYKYAYCSYYLHDWLQAENLFKQFVEVFPTSAKAEEMEYMRAFTYYRQSPKA
ELDQTNTQKTIGLMQTFINTHPNSPRNKEASDIMDKCRIKLEEKEVGSAQLYYNMSHYRA
AAIAYTSLMADFPDSPKGDTYKLQVIKSYYLFAMNSIEDKKPARFEQVVSECHDFLDRFP
ESTLKKEVENYETLAKNNIKATNNEQITKTN
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcagccttaataattgcaataatagccctaagcgtagcgtcctgctccaagttt
tcccgggtgcagaagagtaccgactatgattacaaattgcgcatggcagaaaaatactat
gtagccaagaagtataactatgcctcgcaattgtatgaagaactcttccccatcatgaag
ggacaaccacagtttgaagacttattttataagtatgcctactgttcttattatttgcac
gactggctgcaggccgaaaacctgttcaaacagtttgtagaggtgtttcccaccagtgca
aaagccgaggaaatggaatacatgcgggcttttacctattaccggcagtcgcccaaggct
gagctcgatcaaaccaatacccagaaaacaattggtttgatgcagacgtttattaatacg
catcccaattcgcccaggaataaagaggcatcggacatcatggataaatgccgtataaag
ctggaagagaaggaagtaggaagcgcccaattgtattataatatgagccattaccgggcg
gcagcgatcgcttacaccagtttaatggccgattttcctgattcgccaaaaggtgatact
tataagttgcaggttatcaaatcttactatttatttgccatgaatagtatagaagataag
aaacctgcccgttttgaacaggtggtttcggaatgccatgattttctggaccgtttcccc
gaaagcacgctgaaaaaggaagtagagaattacgagacattagcaaaaaataacattaaa
gccaccaataatgagcaaattacgaagacaaattag

DBGET integrated database retrieval system