KEGG   Niastella koreensis: Niako_5113Help
Entry
Niako_5113        CDS       T01679                                 

Definition
(GenBank) OmpA/MotB domain protein
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA OMP_b-brl PagL
Motif
Other DBs
NCBI-ProteinID: AEW01352
UniProt: G8TB05
Position
complement(6340710..6342401)
Genome map
AA seq 563 aa AA seqDB search
MASKKYVSIISLTFLLASAASQAQLGGTYDVQDSSVIPSKRLPQHTEFMANNYPYPAKPR
NQWEIGLQVGAMDISGDVRNRFPGFGGALHARKALGYVFSLRGQLGVYTTKGLNFQPSYQ
WSKNTAWTSAGYAAGTPVFYNYKTNVYDLSLQGVVTLTNIRFHKAKSNFNLYMFGGIGGM
IYDTKIDALKGDGTNYAADFQTIFNKYAATTDGFGYKNRKSIKKDLKNVLDGKYETQGET
DNSQPKLFKKPFRPIFVAGAGAQFKLNKKFSLALEDKLTFSKTDLLDGQQWQENGVATSV
AGFQSAPAQTRDFDTYNFFSLGINMAIGNKAVEPLWWLNPLDYAYNEVNKPRHMKLPKPV
LDDADGDGITDQFDQEPNTPAGAPVDSHGVSRDTDGDGVPDYKDKELVTPTQCQPVDADG
VGKCPPPACCDSLQKLIEEGGIKGKCKIGNLPSVTFKAKSITLSNDAKALLAAAASQIKN
NPDCKIAVIGYCSSSKSEQQLSWDRVNAVISYLVDKEGVSQERFIFKYGEAGGDCNTVDL
RDGTGEEGPTTVPAPHPNLRRGR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaaaaagtacgtaagtattataagcttaacgttcctgttagcatctgcggcc
tcccaggcacaattgggtggtacctatgacgtacaggactcttctgttataccttctaag
aggctccctcagcacaccgagttcatggcaaacaattacccttacccggccaaaccccgt
aatcaatgggaaataggcttacaggtaggtgctatggacatttccggtgatgttcgtaac
cgttttcctggttttggcggagcattacatgctcgtaaagcgctgggttatgtgttctct
ttaagaggtcaattaggtgtttataccactaaggggttgaactttcaaccttcatatcaa
tggtcaaaaaataccgcctggacttcagccggctatgctgccggaactccagtgttctac
aactacaaaacaaatgtttacgacctgagcttacagggcgtggtaacattgactaacatt
cgctttcacaaagcaaaaagtaacttcaatttatacatgttcggcggtatcggtggtatg
atctatgacaccaaaatagatgctctgaaaggagatggtaccaattatgcagccgatttt
cagacaatctttaataaatacgcagctactactgatggctttggatacaaaaacagaaaa
tccatcaaaaaagacctgaaaaatgtattggacggtaaatatgaaacacagggtgaaaca
gataactctcagcctaaattgttcaaaaagccattccgccccattttcgtagctggtgcc
ggtgctcaattcaaactgaacaaaaagttcagcctggccctggaagataaactgaccttc
tctaaaacagacttgttagatggtcaacaatggcaggaaaacggtgttgctacatccgtt
gctggtttccaatctgcacctgctcaaacaagagactttgatacttataacttcttctct
cttggtatcaacatggcaattggtaacaaagctgttgaacctttgtggtggctgaatcct
ttggattacgcttacaacgaggttaacaaaccacgccacatgaagctccccaaaccagtt
ttggatgatgctgatggcgatggtattactgaccagtttgaccaggagcctaacacacct
gccggcgctcctgttgacagccatggtgttagccgcgatactgatggtgacggtgttcct
gactacaaagacaaggaactggttacaccaacacaatgtcaacctgttgatgctgatggt
gtaggtaaatgtcctcctcctgcatgctgcgattctcttcagaaactgatcgaagaaggt
ggaatcaaaggcaaatgcaagatcggtaacttaccaagcgttaccttcaaagcaaaatca
atcacattaagcaacgacgctaaagctttactggctgcagctgcttcacaaatcaagaat
aaccctgattgtaagatagctgtgatcggatattgctcttcaagcaaatctgaacaacag
ttaagctgggatcgtgtgaatgccgttatcagctacctggttgataaagaaggcgttagc
caagaacgtttcatcttcaaatatggtgaagccggtggcgattgcaacacggtagacctg
cgcgatggaactggcgaagaaggtcctaccacagtgcctgctccgcacccgaacttgcgt
cgcggcagataa

DBGET integrated database retrieval system