KEGG   Niastella koreensis: Niako_6084Help
Entry
Niako_6084        CDS       T01679                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase (NAD(P))
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
nko  Niastella koreensis
Pathway
nko00670  One carbon pool by folate
nko01100  Metabolic pathways
nko01120  Microbial metabolism in diverse environments
nko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Niako_6084
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Niako_6084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AEW02309
UniProt: G8T8V2
Position
7556353..7557306
Genome map
AA seq 317 aa AA seqDB search
MKVIDHIRQAKDSLISFEILPPLKGKTINSIYEHLDPLMEFKPAFINVTYHRSEHVFKKK
ADGTFEKVEVRKRPGTVGICAALMNHYRVDAVPHLICGGFNKRETEDALIDLNFIGVDNV
LVLRGDAAKNETVFEPEKGGNSYAIDLLKQVQNLNTGIYLEEDIRDGFKTDFCCGVAGYP
EKHFEAPNLQTDLAFLKAKVAAGAEYVVTQMFFDNQKYFDFVKRCRENGITIPIIPGLKP
ITSKKQLSVIPRTFHVDIPDDLANEIMNCKTDVEVEKVGTEWLLLQSKELKKAGVPVLHY
YTLGKPKVIYNVVKEIK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatcgatcacattcgccaggcgaaagattcgcttatttcctttgaaatatta
ccccccttaaaaggtaaaaccatcaattcaatatacgagcaccttgacccgctgatggag
ttcaagcctgcttttattaatgttacctaccaccgcagcgagcatgtttttaaaaagaaa
gccgatggcacttttgaaaaagtagaagttcgcaaacgccctggcactgttggtatttgt
gcagccctcatgaaccattatagggttgatgcagtcccgcaccttatttgcggcggtttt
aacaagcgggaaactgaagacgctctgatcgatctgaactttattggtgttgacaacgta
ctggttttacgtggcgatgcagctaagaatgaaactgtatttgaaccggagaaaggcggc
aacagttatgctattgacctgttgaaacaggttcaaaacctgaataccggtatttacctg
gaagaagacatccgtgatggctttaaaaccgatttctgctgcggtgtggccggctacccc
gagaaacattttgaagcacccaacctgcaaaccgatctggctttcctgaaggccaaagta
gctgccggcgccgagtatgtagtaacgcaaatgtttttcgataaccaaaaatatttcgac
tttgtaaaacgttgccgcgaaaatggcatcaccatacccatcattccgggattgaaacct
attaccagcaaaaaacagctgtcggttattccccgcaccttccacgtagatattcccgat
gacctggccaatgagatcatgaactgcaaaacagatgttgaagttgaaaaagtgggaaca
gaatggctgttattgcaatcgaaagaattgaaaaaagccggtgtaccggtgctgcattat
tataccctgggtaagcccaaggtgatctacaatgtagttaaggaaataaagtaa

DBGET integrated database retrieval system