KEGG   Niastella koreensis: Niako_6868Help
Entry
Niako_6868        CDS       T01679                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
nko  Niastella koreensis
Brite
KEGG Orthology (KO) [BR:nko00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Niako_6868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AEW03090
UniProt: G8TMR9
Position
8409329..8409715
Genome map
AA seq 128 aa AA seqDB search
MVSKISEGIEISVETFYQPDYSNPVSGEYMFAYRITIENHNNYPVKLHRRHWYIIDSNGT
NREVEGEGVVGVQPTLQPGERYQYVSGCNLRSEMGKMHGTYLMENLFNKTSFDVNIPVFE
MIVPFKMN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaaagatttccgaaggcatagaaataagtgtcgaaacgttctatcaacccgat
tattccaaccctgtatcgggagaatatatgtttgcctaccggatcaccattgaaaatcac
aacaactatccagttaaactgcaccgccgccactggtatattatcgacagcaatggaacc
aatcgtgaagtagaaggcgaaggggtagtaggcgttcaacccactttacaacccggcgag
cggtatcagtatgtaagcggttgcaacctgcgcagcgaaatgggtaaaatgcatggcacc
tatctcatggagaatttgtttaataaaacatcgttcgatgtgaatattcccgtgtttgag
atgattgtgccgtttaagatgaattga

DBGET integrated database retrieval system