KEGG   Niastella koreensis: Niako_6886Help
Entry
Niako_6886        CDS       T01679                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nko  Niastella koreensis
Brite
KEGG Orthology (KO) [BR:nko00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Niako_6886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TMEM154
Motif
Other DBs
NCBI-ProteinID: AEW03108
UniProt: G8TMT7
Position
complement(8428138..8429208)
Genome map
AA seq 356 aa AA seqDB search
MFTLLVVIIILGLAFDLINGFHDAANSIATVVSTKVLTPFQAVVWAAMFNFIAYWIFDLK
VANTVAKTVHADSINLYVIMAGLIAAIFWNLLTWWFGIPSSSSHTLIGGFAGAAVAHAHS
FSVINQGTIFNIMLFIVLAPFIGMIIAFIITVIIVNLCRRANPYQADKWFRRLQLLSSAA
FSLGHGGSDSQKVIGIITASMVVFGAWCVKNGMPVPHWAHIQEVVDAHGKSSYAHVPQWI
PITCYLCIGAGTMMGGWRIIKTMGTKITKVTPLEGVAAETAGALTLYGVSQGLGVPVSTT
HTIVGSIMGVGMTKRLSAVRWGVSINLLWAWILTIPVSGLLAAIVYYILKLINPVA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtttacattattagttgtaattattatactcggactggccttcgatttgatcaatggt
tttcatgacgctgccaactccatagccacagttgtttcaaccaaagtactcactcctttt
caggcagtagtttgggcagccatgttcaacttcatagcctattggatctttgacctgaaa
gtggccaacaccgttgccaaaaccgtacacgccgattccattaacttatatgtaattatg
gccggccttatagccgccattttctggaacctgcttacctggtggtttggtattccttcc
agttcatcgcataccctcattggtggttttgcaggcgcagctgtagcgcacgctcacagc
ttcagcgttattaaccagggaaccatctttaatatcatgctattcattgtactggctccc
tttataggcatgatcatagcatttattataacggtcataatagtcaacctatgccgaagg
gctaatccctaccaggcagataaatggtttcgccgtttgcagctattatcttccgccgcc
ttcagtttaggccacggtggcagcgattcgcaaaaagtgatcggtattatcaccgcctcc
atggtggtatttggcgcctggtgcgtgaaaaatggaatgcctgtaccacactgggcccat
attcaggaagtggtagatgcccatggtaaatctagctatgctcatgtgccccaatggata
cctatcacctgttacttgtgtattggtgcaggtaccatgatgggtggctggcgtattatt
aaaaccatgggaacaaagatcactaaggttaccccgctcgaaggggtggctgccgaaacc
gccggtgcgcttaccctctacggcgtttcgcagggattgggtgtacccgtgagtaccacg
cataccatcgtaggttctattatgggtgtgggtatgaccaaacgtttatcggctgtacgc
tggggcgtttccattaacctgttatgggcatggatcctcaccattccagtgagcggcctt
cttgcagctattgtgtattatattctgaaattgatcaatcctgttgcttaa

DBGET integrated database retrieval system