KEGG   Niastella koreensis: Niako_7321Help
Entry
Niako_7321        CDS       T01679                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
nko  Niastella koreensis
Pathway
nko00471  D-Glutamine and D-glutamate metabolism
nko00550  Peptidoglycan biosynthesis
nko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Niako_7321
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Niako_7321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nko01011]
    Niako_7321
Enzymes [BR:nko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Niako_7321
Peptidoglycan biosynthesis and degradation proteins [BR:nko01011]
 Precursor biosynthesis
  Amino acid ligase
   Niako_7321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Glyco_transf_54
Motif
Other DBs
NCBI-ProteinID: AEW03535
UniProt: G8TCT1
Position
8976668..8978026
Genome map
AA seq 452 aa AA seqDB search
MELVITMSKRLVILGAGESGVGTAILGRKQGYDVFVSDGGPVKEKYQEELNKYGIAWEAN
QHTEEKILNADEVMKSPGIPEKNELVKKIRKKGIPVISEIEFAYRYKGNSKIIGITGSNG
KTTTTSLMYHICKTAGLDCALVGNIGYSFAKQVAEDPKPLYVAEISSFQLDDIQTFRPDV
AILTNISEDHLDRYDYRFENYIHSKFRIAENQTAQDYFIYCADDQVTMQYLEKYSIKSNP
LPFSMSKELPQGGFIRNGQMTVTVDDEKMQMNVSDFTLKGKHNQNNTMAAALGGATMGIR
KEKIRVAVQTFESLAHRMEPVSTVRGVEFINDSKATNVNSTWFALESMERPTILILGGVD
KGNDYSVLLELVREKVKAIVCLGTDNRKIHEAFKNDVQLIVNTGSADEAVKAAFHFASPG
DTVLLSPACASFDLFKNYEDRGDQFKQAVREL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggagttagtaattacaatgagtaagcgtttggtaatacttggggccggcgaaagcggc
gtaggcactgccatccttggcaggaagcaggggtatgatgtatttgtatcggacggtggg
ccagttaaagagaagtaccaggaagagctgaataagtatggaatagcgtgggaagcaaat
caacataccgaagaaaagattttgaatgcagatgaagtgatgaagagtccgggcattcct
gaaaagaacgagttggtaaagaagatcaggaaaaaaggaataccggttatcagtgaaatt
gaatttgcatatcgctacaaaggcaacagtaagatcattggcattaccggtagtaacgga
aaaacaactacgacgtcgctcatgtaccacatttgcaaaacagcagggttggactgtgcg
ctcgtaggaaacatcgggtattcatttgcgaaacaggtagcggaagatccaaagccattg
tatgtggccgagatcagcagctttcagttagatgatatccaaacgttcagaccggatgta
gcaatactcaccaatatctcagaagaccatttggatcgctatgattaccggttcgagaat
tatatacacagtaagttcaggattgcggagaaccaaacagcgcaggactatttcatttac
tgtgccgatgaccaggtgaccatgcaatacttagagaaatattccatcaaatctaaccca
ttaccattcagtatgagtaaagaattaccccagggcggctttatcaggaacggacagatg
actgtaacagttgacgatgagaagatgcaaatgaatgtgagcgattttacattaaagggc
aaacacaaccagaataatacaatggcagcagcattaggtggtgcaacgatggggatccgc
aaggagaagatccgcgtagccgttcaaacatttgagtcgctggcacacagaatggagccg
gtgtctacagtgcgtggtgttgaatttatcaacgacagcaaagccaccaatgtgaacagc
acctggtttgcgctggaaagcatggagcgccctactattttgattttgggtggagtagat
aaaggaaatgattattcagttctgttagaactcgttcgcgaaaaagtaaaagcgatcgtt
tgtctgggaactgataatcgcaaaatacacgaagcatttaaaaacgatgtacagctgata
gtgaataccggcagtgcagacgaagcagtaaaagcggcatttcattttgccagtcccggc
gataccgtgttgttaagtccggcctgcgccagcttcgacctgttcaagaactatgaagat
cgtggcgatcagttcaaacaggccgttcgcgaattatga

DBGET integrated database retrieval system