KEGG   Candidatus Nitrosopumilus koreensis: NKOR_02700Help
Entry
NKOR_02700        CDS       T02304                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr00010  Glycolysis / Gluconeogenesis
nkr00071  Fatty acid degradation
nkr00350  Tyrosine metabolism
nkr00625  Chloroalkane and chloroalkene degradation
nkr00626  Naphthalene degradation
nkr01100  Metabolic pathways
nkr01110  Biosynthesis of secondary metabolites
nkr01120  Microbial metabolism in diverse environments
nkr01130  Biosynthesis of antibiotics
nkr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_02700
  Lipid metabolism
   00071 Fatty acid degradation
    NKOR_02700
  Amino acid metabolism
   00350 Tyrosine metabolism
    NKOR_02700
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NKOR_02700
   00626 Naphthalene degradation
    NKOR_02700
Enzymes [BR:nkr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NKOR_02700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C DapB_N TrkA_N MTS SDH_sah 3HCDH_N Urocanase NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFS80434
UniProt: K0B4T6
Position
466657..467709
Genome map
AA seq 350 aa AA seqDB search
MKSARITGPNEPLAVTESETPKPQGSQVLVKVKSVGVCHSDLHLWEGGYDLGDGQFMKVT
DRGVKYPVTPGHEIAGTVEEIGDSVSGISIGDEVLVFPWIGCGECPACKVGNENLCDTPK
SLGVFQDGGYSDYSLIPDSKYLAKLDGVDSDSATSLACSGLTAYTAIKKANQNSPEFLVI
VGAGGLGLMGVQIAKAITNAKIVCVDLDDQKLETAKEMGADFTVNSKDPETVQKIMSICN
DKGADSVVDFVNAPPTVKTGLAVLRKRGNLVLVGLFGGSLELSLVTIPLKSILIQGAYTG
NYNDMVELLALARKGTINPVISKRYSLNDANNALEDLKARKILGRAVINP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgctaggataactggcccaaatgagccacttgcagtaactgaatctgaaacc
cccaaacctcaaggtagtcaagttttagtcaaagtaaaatctgtaggtgtttgtcatagt
gatttgcatttgtgggaaggtggctatgatcttggtgatggtcaattcatgaaagtaact
gatagaggggtaaaataccctgtaactcctggccatgaaattgctggaactgttgaagaa
attggtgattctgtttctggaatttctataggtgatgaagtgttagttttcccctggata
ggatgtggtgaatgtcctgcatgtaaagtaggaaatgaaaatctttgcgatacaccaaaa
tcactgggtgtttttcaagatggtggttattctgattattctttaatccctgattcaaaa
tatttggcaaaacttgatggtgttgattctgattctgcaacgtcgcttgcatgttctgga
cttactgcatatactgctatcaaaaaagcaaatcaaaactctcctgaatttcttgtaatt
gttggtgctggtggattgggactgatgggcgtacaaattgcaaaggcaataactaatgca
aagattgtctgtgtagatttagatgatcagaaattagaaactgcaaaagagatgggtgct
gattttacagtaaactcaaaagatcctgagactgttcaaaaaattatgtctatatgcaat
gataaaggcgctgatagcgtagttgattttgttaatgcccctcctacagtaaaaactggc
ttggctgttttacgtaagagaggtaatctagtattggtaggattatttggcggttctttg
gaactatctcttgtaaccattcctctaaaatctattcttattcaaggagcatatactgga
aactataatgatatggttgaacttcttgcacttgcaagaaagggaacaatcaatcctgtg
atttcaaaaaggtattctcttaatgatgcaaataatgcattagaggatcttaaggcacgt
aagattcttggacgcgcggtaatcaatccttga

DBGET integrated database retrieval system