KEGG   Candidatus Nitrosopumilus koreensis: NKOR_04595Help
Entry
NKOR_04595        CDS       T02304                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr00260  Glycine, serine and threonine metabolism
nkr00750  Vitamin B6 metabolism
nkr01100  Metabolic pathways
nkr01110  Biosynthesis of secondary metabolites
nkr01120  Microbial metabolism in diverse environments
nkr01230  Biosynthesis of amino acids
Module
nkr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NKOR_04595
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NKOR_04595
Enzymes [BR:nkr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NKOR_04595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFS80807
UniProt: K0B6Q9
Position
complement(764319..765656)
Genome map
AA seq 445 aa AA seqDB search
MKGDAYLKCIDPQCGLEYPIESTIVHCDKGHLLDVKYKNAPSDNLKEVFDKRHNPHGSIF
NESGVWRFRELLNFCQIDTEDIEECSKYLVSLDGAEGRLSKPYHMSKAAEFVGISNENFW
LQPEGYNPSGSFKDNGMATAVTHAKMVGAKKIVCASTGNTSASAGMFAANEGINCDVYIP
SGQIAPGKLSQAYQFGAQILEIDGNFDDALKQSLDDAQNHDGYTVNSINPFRIEGQKTIP
FRVLEYLNWETPDWIVYPGGALGNTSSCGKALMELYEWGWIKKIPRIAVINSEGASTLSD
LYNGKFEGEELRWNKGKPNTELITRYYDYLDKEGIRPKTKATAIQIGRPANILKGLRALE
FTNGVVTTVSDSDMLDGMSVVGLNGFDCEMASGASVVGVKKLINEGVISKDDTVVGILTG
RQKDAMLPVDYHNNPQNKFANPPKN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagacgcttatctcaaatgtattgatccacaatgcggtttagagtatcctata
gaaagtacaattgtacattgtgataagggtcatctgcttgatgtaaaatacaaaaatgca
ccatctgacaatctaaaagaggtatttgacaaaagacataatcctcatggaagtattttt
aatgaaagtggggtttggcgatttagagagttactcaacttttgccagattgatacagaa
gacatagaagagtgttcaaaatatttagtttcacttgatggggcagaaggaagattatca
aagccataccacatgtcaaaagctgcagaatttgtagggatttccaatgaaaacttttgg
ctacaaccagaaggatacaatccaagtggttcattcaaagataatggaatggcaacggca
gtgactcatgcaaaaatggtaggtgcgaaaaagattgtttgtgcatcaactggaaacaca
tctgcatcagctggaatgtttgcagcaaatgaagggataaattgtgatgtatacattcct
tcaggacagattgccccaggaaaattaagtcaagcctatcaatttggagctcagatatta
gagattgatggaaattttgatgatgcattaaaacagtcattagatgatgcacaaaatcat
gacggatatactgtaaattctatcaatccatttagaatagaaggacaaaaaacaattcca
tttagagtgttagaatatttgaactgggaaacaccagattggattgtttatcctggagga
gcattaggaaatacatctagttgtggaaaagcattaatggaattatatgaatggggatgg
attaaaaaaattccaagaatcgcagtcataaattctgaaggtgcaagcacattatcggat
ttgtataatggtaaatttgaaggagaggagctgagatggaacaaaggaaaacctaacaca
gaattaattacaagatattatgattatttggataaagaaggtatacgaccaaaaacaaaa
gctactgcaattcaaattggaaggcctgcaaatattttgaaaggtttacgtgcattagaa
tttacaaatggtgtggtaacaactgtttcagattcagatatgcttgacggtatgtctgta
gtgggtcttaatggatttgattgtgagatggcatcaggagcctcggtagtaggcgttaag
aaattaatcaatgagggagttatcagtaaagatgacacagtagtaggaattcttacaggt
aggcaaaaagatgcaatgcttcctgtagattatcacaataatccacaaaataaatttgca
aatcctccaaaaaattag

DBGET integrated database retrieval system