KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05385Help
Entry
NKOR_05385        CDS       T02304                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr00010  Glycolysis / Gluconeogenesis
nkr00051  Fructose and mannose metabolism
nkr00562  Inositol phosphate metabolism
nkr01100  Metabolic pathways
nkr01110  Biosynthesis of secondary metabolites
nkr01120  Microbial metabolism in diverse environments
nkr01130  Biosynthesis of antibiotics
nkr01200  Carbon metabolism
nkr01230  Biosynthesis of amino acids
Module
nkr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_05385
   00051 Fructose and mannose metabolism
    NKOR_05385
   00562 Inositol phosphate metabolism
    NKOR_05385
Enzymes [BR:nkr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NKOR_05385
Exosome [BR:nkr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NKOR_05385
  Exosomal proteins of bladder cancer cells
   NKOR_05385
  Exosomal proteins of melanoma cells
   NKOR_05385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS FMN_dh NMO
Motif
Other DBs
NCBI-ProteinID: AFS80963
UniProt: K0B4A5
Position
891862..892518
Genome map
AA seq 218 aa AA seqDB search
MFVINCKNYEEISGDKIIKFVKIAEKISKKFKIKIAICPPQHLIGVVANSSIPIFAQHVD
DSNVGSTTGFVIPELLKKSKVNGSLINHSEHRILSKEISKIVSKLKDLKMTSIVCVRDVA
EARKYAKLNPDYIAIEPPELIGSGKSVSTHRPELITKAAIAVKDAKNNTKLLCGAGIISG
KDVSKAVELGSKGILVASGIIKAKDWNKIISEFAKALV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaatcaattgtaaaaattatgaagaaatttcaggagacaaaatcattaaattt
gtaaaaattgctgaaaaaatttcaaaaaaatttaagataaaaattgcaatatgtccacct
cagcacctcataggagttgttgcaaatagttcaattccaatttttgcacaacatgttgat
gattccaatgtaggtagcacgacaggttttgtaataccagaattactaaaaaaatccaaa
gtaaatggatcattgatcaaccatagcgaacatagaattttatcaaaagagatttcaaaa
atagtatcaaagttaaaagatctgaaaatgacatcaattgtttgtgtgagagatgtagca
gaggcaagaaaatatgccaaactaaacccagattacattgcaatagaacctccagagctt
ataggttcaggaaaatcagtatcgactcatagaccagaactaataacaaaagctgcaatc
gcagtaaaagatgcaaaaaataacacaaaacttctttgtggtgcaggaattatttcagga
aaagatgtttcaaaagcagttgaattaggttcaaaaggaattctagttgcaagcggtata
atcaaagcaaaagattggaacaaaataatttctgaatttgccaaggcattagtttaa

DBGET integrated database retrieval system