KEGG   Neisseria lactamica: NLA_11100Help
Entry
NLA_11100         CDS       T01368                                 

Definition
(GenBank) putative acyl-CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nla  Neisseria lactamica
Pathway
nla00061  Fatty acid biosynthesis
nla00071  Fatty acid degradation
nla01100  Metabolic pathways
nla01212  Fatty acid metabolism
nla02024  Quorum sensing
Module
nla_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NLA_11100
   00071 Fatty acid degradation
    NLA_11100
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NLA_11100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nla01004]
    NLA_11100
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nla04147]
    NLA_11100
Enzymes [BR:nla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     NLA_11100
Lipid biosynthesis proteins [BR:nla01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   NLA_11100
Exosome [BR:nla04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   NLA_11100
  Exosomal proteins of breast cancer cells
   NLA_11100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBN87332
UniProt: E4ZD99
Position
1183638..1185191
Genome map
AA seq 517 aa AA seqDB search
MNRTYANFYEMLTAACRENGNGTAVFDGKEKTAYRALKQEAEAVAAYLQNIGVKFGDTVA
LAVSNSTEFITAYFAVSAIGAVAVPMNTFLKNSEYAYILNDCKARFLFASAGLSKELAGL
KAQTPVEKIIWTGQSLPAGKTAEGDAFFEDVRRFPEKPDLGRQPRINDLAHIIYTSGTTG
HPKGALISYANLFANLNGIERIFKISKRDRFIVFLPMFHSFTLTAMVLLPIYMACSIILV
KSVFPFSNVLKQALLKRATVFLGVPAIYTAMSKAKIPWYFRWFNRIRLFISGGAPLAEQT
ILDFKAKFPRAKLLEGYGLSEASPVVAVNTPERQKARSVGIPLPGLEVKAVDEELVEVPR
GKVGELIVRGGSVMRGYLNMPAATDETIVNGWLKTGDFVTIDEDGFIFIVDRKKDLIISK
GQNVYPREIEEEIYKLDAVEAAAVIGVKDRYADEEIVAFVQLKEGMDLGEDEIRRHLRTV
LANFKIPKQIHFKDGLPRNATGKVLKRVLKEQFDGNK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggacttatgccaatttctacgaaatgctgaccgccgcctgccgcgaaaacggc
aacggcacggcagtgttcgacggcaaggaaaaaaccgcctaccgcgcgctcaagcaggaa
gccgaagccgtcgcggcgtatctgcaaaatatcggcgtgaagttcggcgacacggtcgcg
ctggcggtttccaattccacagaatttattaccgcctatttcgccgtatccgccatcggc
gcggtcgccgtaccgatgaacacatttttgaaaaacagcgaatacgcgtatatcctgaac
gactgcaaggcgcgcttcctgttcgcctcggccggcctatccaaagaattggcgggcttg
aaggcgcaaacgcccgtcgaaaaaatcatttggacggggcaaagcctgccggcgggcaaa
acggcggaaggcgatgccttttttgaagacgtgcgccgcttccccgaaaaacccgacttg
ggccgccaaccccggataaatgatttggcacacatcatctacacctccggcacgacgggg
catcccaaaggcgcgctaatcagttacgccaacctgttcgccaacctgaacggcatcgaa
cgcatctttaaaatttccaaacgcgaccgctttatcgttttcctgccgatgttccacagc
ttcacgctgacggctatggtgctgctgccgatttatatggcgtgttcgattattttggtc
aaatccgttttcccgttttccaacgttttgaaacaggccctgctcaaacgcgcgaccgtt
tttttgggcgtacccgcgatttacaccgcgatgagcaaggcgaaaatcccttggtatttc
agatggttcaaccgcatccgcctgtttatcagcggcggcgcgcctttggcggaacaaacc
atcctcgatttcaaagccaagttcccccgcgccaaattgctggaaggctacggactgagc
gaagcctcgcccgttgtcgccgtcaatacgcccgaacggcaaaaagcccgcagcgtcggc
atccccctgcccggtttggaagtcaaagccgtcgatgaagaattggtcgaagtgccgcgc
ggcaaagtgggcgaactgattgtcaggggcggttcggtgatgcggggctacctcaatatg
cctgccgccaccgatgaaaccatcgtcaacggctggttgaaaacgggcgatttcgttacc
atagacgaagacggctttatctttatcgtcgaccgcaaaaaagatttgattatttccaaa
ggtcaaaatgtctatccgcgcgagatcgaagaagaaatctacaaactcgatgccgtcgaa
gccgccgccgtcatcggcgtgaaagaccgttatgccgacgaggaaatcgtcgccttcgtc
caattaaaggaaggtatggatttgggcgaggacgaaatccgccgccacctgcgtaccgtg
ctggcaaatttcaaaatccccaaacaaatccactttaaagacgggctgccgcgcaacgct
acgggtaaggtattgaaacgggtgttgaaggagcagtttgacggaaacaaatga

DBGET integrated database retrieval system