KEGG   Neisseria lactamica: NLA_13050Help
Entry
NLA_13050         CDS       T01368                                 

Gene name
sucB
Definition
(GenBank) putative dihydrolipoamide succinyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nla  Neisseria lactamica
Pathway
nla00020  Citrate cycle (TCA cycle)
nla00310  Lysine degradation
nla01100  Metabolic pathways
nla01110  Biosynthesis of secondary metabolites
nla01120  Microbial metabolism in diverse environments
nla01130  Biosynthesis of antibiotics
nla01200  Carbon metabolism
Module
nla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NLA_13050 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NLA_13050 (sucB)
Enzymes [BR:nla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NLA_13050 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CBN87525
UniProt: E4ZDU1
Position
complement(1440264..1441445)
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPVAAPAEAAPAAAPAAAQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgtatcgataccgctgct
actgccgctgccgaagcacccgtagccgctcctgccgaagctgccccggccgccgctcct
gctgctgcacaaaacaacgccgctatgcctgccgccgccaaactggctgccgagaccggc
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccgctgctcctgccgttgcactgcctgccggc
gcacgtcctgaagaacgcgtaccgatgagccgcctgcgtgcccgtgttgcagaacgcctc
ctggcttctcaacaagaaaacgccattttgactacattcaacgaagtcaacatgaaaccg
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaactg
ggctttatgtccttcttcgttaaagccgctgttgccgccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacatcgtgtaccacggctacttcgatatcggtatcgca
attggcagcccacgcggtttggttgtaccaatcctgcgcgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgtcgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtctaccccgatcatcaacccgcctcaatctgcgattttgggtatgcacgccactaaa
gagcgcgctgtggttgaaaacggtcaagttgttgtccgtccgatgatgtatctggctctg
tcttacgaccaccgtatcatcgacggacgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccggctcgcctgttgttggatctgtaa

DBGET integrated database retrieval system