KEGG   Neisseria lactamica: NLA_1320Help
Entry
NLA_1320          CDS       T01368                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nla  Neisseria lactamica
Pathway
nla00900  Terpenoid backbone biosynthesis
nla01100  Metabolic pathways
nla01110  Biosynthesis of secondary metabolites
nla01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NLA_1320 (dxr)
Enzymes [BR:nla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     NLA_1320 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Sacchrp_dh_NADP Mur_ligase
Motif
Other DBs
NCBI-ProteinID: CBN86376
UniProt: E4ZAB5
Position
complement(133369..134604)
Genome map
AA seq 411 aa AA seqDB search
MPSETASDGIRYKVIPIMTPQVLTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEK
LAAQCRTFRPEYAVVADAGHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVMCAI
VGAAGLPSALAAAQKGKTIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAVFQVLP
RDYTGRLNEHGIRSIILTASGGPFLTADLNTFDRITPAQAVKHPNWRMGRKISVDSATMM
NKGLELIEAHWLFDCPPDKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGL
PERIDSGVGDLDFDALSALTFQKPDFDRFPCLKLAYEAMNAGGAAPCVLNAANEAAVAAF
LDGRIKFTDIAKTVAHCLAQDFSDGIGDIGGLLAQDARTRAQARAFIGTLR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaaaccgcttcagacggcatccggtataaagttatccccattatgacacca
caagtcctgaccatattaggcagtaccggcagcataggcgaaagcacgctggacgttgtc
tcccgccaccccgaaaaattccgcgtattcgcgctggcggggcataagcaggtcgaaaaa
ctggcggcgcaatgccggacgttccgccccgaatatgccgtcgttgccgatgccggacac
gccgcccggcttgaagccctgttgaaacgcgacggcacggcaacgcaggttttacacggc
gcgcaggcattggtcgacgttgcgtctgctgacgaagtcagcggtgtcatgtgcgccatc
gtcggggcggcggggctgccttccgcgctggcggcggcgcaaaaaggcaaaaccatttat
ctggcgaacaaagagacgttggtggtttccggcgcgctgtttatggaaacggcgcgcgca
aacggcgcggcagtgttgcccgtcgacagcgaacacaacgccgttttccaagttttgccg
cgcgattacacaggccgtctgaacgaacacggcatccgttcgattatcctgactgcttcc
ggcggcccgtttctgaccgccgatttaaacacgttcgaccgcattacgcccgcccaagcg
gtcaaacaccccaattggcgtatggggcgcaaaatctccgtcgattccgccaccatgatg
aacaaaggtttggagctgattgaagcgcattggctgttcgactgtccgcctgacaagctc
gaagtcgtcatccatccgcagtccgtgatacacagcatggtgcgctaccgcgacggctcc
gtgctggcgcaactgggcaatcccgatatgcgtacgcccatcgcctattgtttgggcttg
cccgagcgcatcgattcgggagtcggcgacctggatttcgacgcattgtccgcactgacc
ttccaaaagcccgactttgaccgcttcccctgcctgaaactcgcctatgaagccatgaat
gcgggcggagccgcgccctgcgtattgaacgccgccaacgaagccgccgtcgccgccttt
ttggacggacggattaagtttaccgatattgccaaaaccgtcgcccactgcctcgcacaa
gacttttcagacggcataggcgatataggggggctcttggcgcaagatgcccggacacgc
gcacaagcgcgggcatttatcggcacactgcgctga

DBGET integrated database retrieval system